SecReT6
Protein ID: 329805032
SecReT6 ID789
T6SS typei3
Gene symbol-
Locus tag329805032
StrainSalmonella enterica GIFU10007
Repliconchromosome [GenBank: JF766712] [Browse all T6SS(s) in this replicon]
Location [Strand]37372..37794 [+]
Producthypothetical protein
NoteTssA
UniProt IDF5CQ93, F5CQ93
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 5.60E-19, Aligned region: 51..110
Protein Sequence: 140 a.a.     [Download]
>gi|329805032|ref|AEC05344.1| hypothetical protein [Salmonella enterica]
MDMSLTKPVSAEQPCGPDPEYDPEYLLLFSRAAPQAEAQYGDFVSTPEAVNWPEIERDARRLLTRSKDIR
VLILLLRSRIQQAGAQGLAEMLTQLAELSVIWSDALHPQLLTGEGASAESIEDAALARSNALAARWITKA
 
Nucleotide Sequence: 423 bp     [Download]
>gi|329805030|gb|JF766712|:37372-37794
ATGGACATGTCCCTGACTAAACCGGTAAGCGCGGAACAACCCTGCGGCCCCGATCCGGAGTACGATCCGG
AATACCTGCTGCTGTTCAGCCGCGCCGCCCCCCAGGCGGAGGCGCAATATGGTGATTTTGTCAGTACGCC
GGAAGCCGTGAACTGGCCGGAAATTGAGCGTGATGCGCGCCGTCTGCTCACGCGCAGTAAGGATATCCGG
GTGTTGATCCTGCTGCTGCGCAGTCGCATCCAGCAGGCTGGCGCACAGGGACTGGCGGAAATGCTCACAC
AACTGGCAGAACTGAGCGTAATCTGGTCTGATGCACTCCATCCACAGCTGCTTACCGGCGAAGGCGCATC
CGCAGAATCTATTGAAGATGCGGCGCTGGCGCGCAGTAATGCCCTGGCGGCGCGCTGGATCACGAAGGCG
TGA