SecReT6
Protein ID: 329805036
SecReT6 ID789
T6SS typei3
Gene symbol-
Locus tag329805036
StrainSalmonella enterica GIFU10007
Repliconchromosome [GenBank: JF766712] [Browse all T6SS(s) in this replicon]
Location [Strand]33155..33979 [+]
Producthypothetical protein
NoteTagJ
UniProt IDF5CQ89
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 7.30E-46, Aligned region: 143..266
Protein Sequence: 274 a.a.     [Download]
>gi|329805036|ref|AEC05348.1| hypothetical protein [Salmonella enterica]
MKKTDTLPATLSALLQEYSIAEGIQMAEQQVRENPAKALCRHSLFQLLCVAGDWARALHQLQLCARMEAN
YTQEARLYRELVCCEMFRHTVFQGEQRPGFLLPQPVWVESLLAALACHDDTGEVDKHRNTALEAITDTGG
QWNGGAFDWASDSDSRLGPVLELVTGGVYIWLPFSQIRSLESPQPTRLTDLLWKPVNITLVNGDTHGAWL
FTRYSGSESASDALRLCRETAWQDGPGETTVRALGQKVWLTSHGDISLLDMTHCTFHAQENDGA
 
Nucleotide Sequence: 825 bp     [Download]
>gi|329805030|gb|JF766712|:33155-33979
ATGAAAAAAACTGACACGCTTCCTGCTACCCTGTCCGCGCTGCTACAGGAATACTCTATTGCGGAGGGGA
TTCAGATGGCGGAGCAGCAGGTTCGGGAAAATCCGGCGAAGGCGCTCTGCCGCCACAGCCTGTTTCAGTT
GCTGTGTGTGGCCGGAGACTGGGCGCGGGCGCTACACCAGCTTCAGCTCTGTGCCAGGATGGAGGCAAAT
TATACCCAGGAGGCCCGGCTGTACCGGGAGCTGGTTTGCTGCGAAATGTTCCGCCACACCGTTTTTCAGG
GTGAACAACGACCCGGTTTTCTTCTGCCGCAGCCCGTTTGGGTGGAGTCACTGCTGGCGGCACTCGCCTG
TCATGACGATACCGGTGAGGTTGATAAACACCGTAATACCGCACTGGAAGCCATAACAGACACGGGCGGG
CAGTGGAACGGCGGCGCATTTGACTGGGCGAGCGACAGCGATTCCCGCCTTGGCCCGGTACTTGAGCTGG
TCACCGGCGGCGTGTATATCTGGCTACCGTTTTCGCAAATACGCTCGCTGGAATCGCCGCAACCGACGCG
CCTGACCGATCTGCTGTGGAAACCCGTTAATATCACCCTGGTGAATGGCGATACGCACGGTGCCTGGCTC
TTTACCCGTTACAGCGGTTCGGAAAGTGCATCTGACGCCCTGCGTCTGTGCCGGGAAACCGCCTGGCAGG
ACGGCCCCGGCGAAACCACCGTGCGAGCGCTGGGGCAGAAAGTGTGGCTGACCAGCCACGGCGATATCAG
CCTGCTGGACATGACCCATTGTACCTTTCATGCTCAGGAAAACGATGGCGCATGA