SecReT6
Protein ID: 329805045
SecReT6 ID789
T6SS typei3
Gene symbol-
Locus tag329805045
StrainSalmonella enterica GIFU10007
Repliconchromosome [GenBank: JF766712] [Browse all T6SS(s) in this replicon]
Location [Strand]25148..25633 [-]
ProductHcp-like protein
NoteTssD
UniProt IDF5CQ80, F5CQ80
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.10E-41, Aligned region: 6..136
Protein Sequence: 161 a.a.     [Download]
>gi|329805045|ref|AEC05357.1| Hcp-like protein [Salmonella enterica]
MAYDIFLKIDGIDGESMDDKHKNEIEVLSWRWNIHQESTMHAGSGLGSGKVSVTNLDFDHYIDRASPNLF
KYCASGKHIPQAILVMRKAGGNPLEYLKYTFTDLIVAVVSPSGSHDGEIASRETVELSFSTVKQEYVVQN
QQGGSGGTITAGYDFKANKEI
 
Nucleotide Sequence: 486 bp     [Download]
>gi|329805030|gb|JF766712|:25148-25633
ATGGCTTATGACATTTTTTTAAAAATTGACGGCATTGATGGCGAGTCAATGGATGACAAACACAAAAATG
AAATTGAAGTACTGAGCTGGCGCTGGAATATTCATCAGGAATCCACCATGCACGCCGGTAGCGGCCTCGG
CTCCGGTAAGGTCTCCGTCACTAATCTGGATTTTGATCACTATATCGATCGCGCCAGCCCGAACCTGTTC
AAATACTGCGCCTCCGGCAAGCACATTCCGCAGGCCATTCTGGTTATGCGTAAGGCTGGCGGCAATCCGC
TGGAGTACCTCAAGTATACCTTCACCGACCTGATTGTCGCCGTGGTTTCCCCGAGCGGCAGCCACGATGG
TGAAATCGCCTCCCGTGAAACGGTCGAGCTTTCTTTCAGCACTGTGAAACAGGAATACGTGGTGCAGAAC
CAGCAGGGCGGCAGCGGCGGCACTATCACCGCAGGTTACGACTTCAAGGCGAACAAAGAAATTTAA