SecReT6
Protein ID: 329805046
SecReT6 ID789
T6SS typei3
Gene symbol-
Locus tag329805046
StrainSalmonella enterica GIFU10007
Repliconchromosome [GenBank: JF766712] [Browse all T6SS(s) in this replicon]
Location [Strand]24545..25081 [-]
Productputative lipoprotein
NoteTssJ
UniProt IDF5CQ79, F5CQ79
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.10E-41, Aligned region: 20..170
Protein Sequence: 178 a.a.     [Download]
>gi|329805046|ref|AEC05358.1| putative lipoprotein [Salmonella enterica]
MNEWRNPTRWLCAVAMPFALLLLSGCGSSDALPDLESQRLDLSVKASDKVNPDNQKKAAPIEIRVYELKN
DAAFTTADYWSLHDNDKSVLTDDLVRRDSFILRPGEEKKLRRPLNAQTTAIGVLAGYRNLAKSVWRVTYK
IPEAPEKAWYSSFIPGKGKVQLEAELEQSAIVITERDK
 
Nucleotide Sequence: 537 bp     [Download]
>gi|329805030|gb|JF766712|:24545-25081
GTGAATGAATGGCGTAACCCCACTCGGTGGTTATGTGCGGTAGCTATGCCTTTTGCACTGCTCCTGCTTT
CCGGATGCGGCAGTAGCGATGCGTTACCTGACCTCGAATCACAGCGACTCGACCTGAGCGTGAAAGCCTC
CGATAAGGTGAATCCTGACAATCAGAAGAAGGCCGCGCCCATTGAGATACGTGTTTATGAACTAAAAAAT
GACGCCGCTTTCACGACAGCTGATTACTGGTCGCTCCATGACAACGACAAATCCGTCCTTACCGACGATT
TAGTGCGTCGCGACAGCTTTATTTTGCGTCCCGGCGAAGAGAAAAAACTGCGTCGCCCGCTGAATGCGCA
GACCACGGCAATCGGCGTACTGGCCGGATACCGTAACCTGGCCAAATCGGTCTGGCGGGTAACCTACAAA
ATCCCGGAAGCCCCGGAAAAAGCCTGGTACAGCAGCTTCATACCGGGGAAAGGAAAAGTGCAGTTGGAGG
CGGAACTGGAACAAAGCGCCATTGTAATTACGGAACGGGATAAATGA