SecReT6
Protein ID: 330810169
SecReT6 ID431
T6SS typei4a
Gene symbol-
Locus tagPSEBR_a3311
StrainPseudomonas brassicacearum subsp. brassicacearum NFM421
Repliconchromosome [GenBank: NC_015379] [Browse all T6SS(s) in this replicon]
Location [Strand]4092891..4093973 [-]
Producthypothetical protein
NoteTssA
UniProt IDF2K7N6
KEGG IDpba:PSEBR_a3311
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.40E-19, Aligned region: 63..122
ImpA-rel_N [PF06812], Evalue: 1.40E-19, Aligned region: 216..233
ImpA-rel_N [PF06812], Evalue: 1.40E-19, Aligned region: 240..265
Protein Sequence: 360 a.a.     [Download]
>gi|330810169|ref|YP_004354631.1| hypothetical protein PSEBR_a3311 [Pseudomonas brassicacearum subsp. brassicacearum NFM421]
MSLPISPLPELVSQLLEPISAESPCGPDLRYEPEYDQLRELRREDDTSLPTGVWQSSIKRALWPDLERLA
TTLLLERSKDLMISAWLGEAWLHMAGLEGLPGSLALVAGLCERYPEQLHPQAEDGDQSWRVIPLEWLARR
YSEVLLTRVPLFDGREQAFAAFSLDDWQRLQRQQVLVNDSKNAKASAEAARNDQKKLGELIRNTPLSFWL
HRQGSLMLSLQHLQRLEAWSDAYLGNLAPGYKSLQDVMQALLTLVEEFIAMHPQQPTVAPVQTSPASTTS
TSQPQAAPAQVFQEPANREEAYRQLMVIAGYLARTEPHSPVPYLIRRGVEWGNKPLSELLGELISADAES
RRLWTLLGVL
 
Nucleotide Sequence: 1083 bp     [Download]
>ref|NC_015379.1|:c4093973-4092891 hypothetical protein PSEBR_a3311 [Pseudomonas brassicacearum subsp. brassicacearum NFM421]
GTGAGCTTGCCGATATCGCCTTTGCCTGAGCTGGTCAGCCAGTTGCTCGAGCCGATCAGCGCCGAATCGC
CCTGTGGCCCGGACCTGCGCTACGAACCGGAATACGACCAGTTGCGCGAATTGCGCCGGGAAGACGACAC
CAGCCTGCCCACCGGCGTGTGGCAGTCTTCGATCAAGCGCGCCCTGTGGCCAGACCTGGAACGGCTTGCG
ACCACGTTGCTGCTTGAGCGCAGCAAGGACCTGATGATCAGCGCCTGGCTGGGGGAGGCCTGGCTGCATA
TGGCCGGGCTGGAGGGGTTGCCGGGTAGCCTGGCGCTGGTGGCGGGGCTGTGTGAGCGCTATCCGGAGCA
GTTGCACCCCCAGGCCGAGGACGGCGACCAGTCGTGGCGGGTGATCCCGCTGGAGTGGCTGGCCCGGCGC
TACAGCGAAGTGCTGCTGACGCGGGTGCCGTTGTTCGACGGCCGGGAGCAGGCCTTCGCCGCTTTCTCCC
TGGACGACTGGCAACGCTTGCAGCGCCAGCAAGTGTTGGTCAACGACAGCAAGAACGCCAAGGCCTCGGC
CGAAGCGGCGCGCAACGATCAAAAGAAACTCGGCGAACTGATTCGCAACACACCCTTGTCGTTCTGGTTG
CACCGCCAAGGCAGCCTGATGTTGAGCCTGCAACACCTGCAACGGCTCGAAGCCTGGAGCGACGCTTACC
TGGGCAACCTGGCCCCGGGCTACAAATCCCTGCAGGACGTGATGCAGGCCTTGCTGACACTGGTAGAGGA
GTTCATCGCGATGCACCCACAGCAACCCACCGTCGCGCCGGTGCAAACGTCCCCGGCATCCACGACGTCG
ACGTCCCAGCCGCAGGCGGCTCCAGCCCAGGTCTTCCAGGAACCGGCCAATCGTGAAGAGGCCTACCGAC
AGCTAATGGTCATCGCCGGTTACCTGGCCCGTACCGAACCCCACAGCCCGGTGCCCTACCTGATCCGACG
CGGCGTGGAGTGGGGCAACAAGCCGTTGAGTGAGTTGCTGGGGGAACTGATCAGTGCCGATGCCGAGTCC
CGGCGCTTGTGGACGTTATTGGGCGTTCTCTAA