SecReT6
Protein ID: 330810171
SecReT6 ID431
T6SS typei4a
Gene symbol-
Locus tagPSEBR_a3313
StrainPseudomonas brassicacearum subsp. brassicacearum NFM421
Repliconchromosome [GenBank: NC_015379] [Browse all T6SS(s) in this replicon]
Location [Strand]4097791..4098552 [-]
Producthypothetical protein
NoteTssL
UniProt IDF2K7N8
KEGG IDpba:PSEBR_a3313
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.30E-40, Aligned region: 16..226
Protein Sequence: 253 a.a.     [Download]
>gi|330810171|ref|YP_004354633.1| hypothetical protein PSEBR_a3313 [Pseudomonas brassicacearum subsp. brassicacearum NFM421]
MPDGSGGAVRSLHEAPLSSAFRQAWLKWSQEWQDLPKDSDPAALVNRVVEFSGRSAQRLWRVAFATVGDA
ATEQVKSLVYAFVALVDETLLFSPWPGQLAWQQHPLESRMYASRQAGERLPAAIKKLLDEQMPGTRDLAN
VYLQCLILGFQGRLRGEPGQVQHEKWRLALFTFAWQHEPDYVDVSQRLALSSATPPVRMPVQQSLPDGFR
LGLAILAMVLLLTGLGQVFWRDIRLELEPVLQLNESVVQEQDS
 
Nucleotide Sequence: 762 bp     [Download]
>ref|NC_015379.1|:c4098552-4097791 hypothetical protein PSEBR_a3313 [Pseudomonas brassicacearum subsp. brassicacearum NFM421]
ATGCCTGATGGAAGTGGCGGGGCGGTTCGGAGTCTGCATGAGGCGCCGCTGAGCAGCGCTTTTCGCCAGG
CCTGGCTGAAGTGGTCCCAGGAATGGCAAGACTTGCCCAAGGACAGCGACCCTGCGGCATTGGTCAATCG
GGTGGTGGAGTTTTCCGGGCGCAGCGCCCAGCGTCTGTGGCGGGTGGCCTTCGCCACCGTCGGCGATGCC
GCTACCGAGCAGGTCAAGTCGCTGGTCTATGCCTTCGTGGCGCTGGTGGACGAAACCTTGCTGTTCAGCC
CCTGGCCCGGACAACTGGCCTGGCAGCAGCACCCCCTCGAATCACGCATGTATGCCAGTCGCCAGGCCGG
CGAGCGCTTGCCGGCGGCGATCAAGAAACTGCTGGACGAGCAGATGCCCGGCACCCGGGACCTGGCGAAT
GTCTACCTGCAATGCCTGATCCTCGGGTTCCAGGGCCGGTTGCGCGGCGAGCCTGGCCAGGTTCAGCATG
AGAAATGGCGCCTGGCGTTGTTCACGTTTGCCTGGCAGCACGAACCCGATTATGTCGATGTCAGCCAGCG
CCTGGCGCTGTCTTCGGCGACGCCGCCAGTGCGCATGCCGGTGCAGCAATCACTGCCGGACGGCTTTCGC
CTGGGGCTGGCGATCCTGGCGATGGTGTTGTTGTTGACCGGGCTGGGGCAGGTGTTCTGGCGTGACATTC
GTTTGGAGCTCGAACCGGTGCTGCAACTGAACGAGTCGGTGGTTCAGGAGCAGGACTCATGA