SecReT6
Protein ID: 330810174
SecReT6 ID431
T6SS typei4a
Gene symbol-
Locus tagPSEBR_a3316
StrainPseudomonas brassicacearum subsp. brassicacearum NFM421
Repliconchromosome [GenBank: NC_015379] [Browse all T6SS(s) in this replicon]
Location [Strand]4100641..4101201 [+]
Producthypothetical protein
NoteTssB
UniProt IDF2K7P1
KEGG IDpba:PSEBR_a3316
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 8.70E-54, Aligned region: 9..161
Protein Sequence: 186 a.a.     [Download]
>gi|330810174|ref|YP_004354636.1| hypothetical protein PSEBR_a3316 [Pseudomonas brassicacearum subsp. brassicacearum NFM421]
MAESTQHKLDRVRPPRVQITYDVEIGNAIEKKELPLVVGILADLSGKPLDPLPKLNERRFTEIDRDNFNE
VLASISPRATLQVNNTLSGDDSKLNIELNFRHIDDFDPVKVVEQVTPLRRLFEARQRLRDLLTKLDGNDD
LDKLLRDVIANTEGLQEIKSARPQDVPPELPAVAANDDPAPAEPQA
 
Nucleotide Sequence: 561 bp     [Download]
>ref|NC_015379.1|:4100641-4101201 hypothetical protein PSEBR_a3316 [Pseudomonas brassicacearum subsp. brassicacearum NFM421]
ATGGCAGAAAGTACCCAGCACAAGCTCGACAGAGTCCGTCCTCCCCGCGTCCAGATCACCTATGACGTGG
AGATCGGCAACGCCATCGAGAAAAAAGAATTGCCACTGGTGGTCGGCATTCTGGCCGACCTCTCAGGCAA
GCCACTGGACCCGCTGCCCAAGCTCAATGAGCGGCGCTTTACCGAAATCGATCGGGATAATTTCAACGAG
GTACTCGCCTCCATCTCCCCCCGCGCCACGCTCCAGGTGAACAACACCCTCAGCGGCGACGACAGCAAGC
TCAACATCGAACTCAACTTCCGTCACATCGACGACTTCGACCCGGTCAAGGTCGTGGAGCAGGTCACGCC
GCTGCGTCGGTTGTTCGAAGCGCGCCAACGCCTGCGGGACCTGTTGACCAAACTCGATGGCAACGACGAC
CTGGACAAGCTGCTGCGCGACGTGATCGCCAACACCGAGGGCCTGCAGGAAATCAAGTCGGCGCGACCCC
AGGACGTACCGCCGGAGCTGCCCGCCGTGGCCGCCAACGATGACCCTGCCCCGGCCGAACCACAGGCCTG
A