SecReT6
Protein ID: 330810175
SecReT6 ID431
T6SS typei4a
Gene symbol-
Locus tagPSEBR_a3317
StrainPseudomonas brassicacearum subsp. brassicacearum NFM421
Repliconchromosome [GenBank: NC_015379] [Browse all T6SS(s) in this replicon]
Location [Strand]4101232..4102713 [+]
Producthypothetical protein
NoteTssC
UniProt IDF2K7P2
KEGG IDpba:PSEBR_a3317
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.10E-190, Aligned region: 66..488
Protein Sequence: 493 a.a.     [Download]
>gi|330810175|ref|YP_004354637.1| hypothetical protein PSEBR_a3317 [Pseudomonas brassicacearum subsp. brassicacearum NFM421]
MPASSSAQTSESTTQTLSLLDKIIAEGRMAHDDSQQDYARDMLAEFATQVLDEGMAIDKDTVAMINDRIS
QIDQLISAQLNEVLHHPDLQKLEASWRGLHLLVQNTETSTRLKLRLLNVTQKELQNDLEKAVEFDQSALF
KKIYEEEYGTFGGHPFSLLVGDYTFGRHPQDIGLLEKLSNVAAAAHAPFIAAASPRLFDMTSFTELAIPR
DLSKIFESQELIKWRAFRESEDSRYVSLVLPHFLLRLPYGPDTLPVEGINYVEDVNGTDHSKYLWGNAAW
TLAQRITEAFAKYGWCAAIRGAEGGGAVEGLPAHTFRTSSGDLSLKCPTEVAITDRREKELNDLGFISLC
HKKNSDVAVFFGGQTTNKAKAYNTNEANANARISAMLPYVLAASRFAHYLKVIMRDKVGSFMTRDNVQTY
LNNWIADYVLINDNAPQEIKAQYPLREARVDVTEVAGKPGAYKATVFLRPHFQLEELTASIRLVATLPPP
VAA
 
Nucleotide Sequence: 1482 bp     [Download]
>ref|NC_015379.1|:4101232-4102713 hypothetical protein PSEBR_a3317 [Pseudomonas brassicacearum subsp. brassicacearum NFM421]
ATGCCTGCTTCATCCAGCGCTCAAACCAGCGAGAGCACGACCCAGACCCTGTCCCTGCTGGACAAGATCA
TCGCCGAAGGCCGCATGGCCCACGACGACAGCCAGCAAGATTACGCCCGCGACATGCTGGCCGAATTCGC
CACCCAGGTCCTCGACGAAGGCATGGCCATCGACAAGGACACCGTGGCGATGATCAACGACCGCATCAGC
CAGATCGACCAGTTGATCAGCGCCCAGCTAAACGAAGTGCTGCACCACCCCGACCTGCAGAAACTCGAAG
CCTCCTGGCGCGGCCTGCACCTGCTGGTGCAGAACACCGAGACCAGCACCCGGCTCAAATTGCGCCTGCT
CAACGTCACCCAGAAAGAACTGCAGAACGATCTGGAAAAAGCCGTCGAATTCGACCAGAGCGCGCTGTTC
AAGAAAATCTACGAGGAAGAATACGGCACCTTCGGCGGGCATCCGTTCAGTCTGCTGGTGGGCGACTACA
CCTTTGGCCGGCATCCCCAGGACATCGGCCTGCTGGAAAAACTCTCGAACGTCGCCGCCGCCGCACATGC
CCCGTTCATTGCCGCGGCCAGCCCGCGGTTGTTCGACATGACCAGCTTCACCGAACTGGCGATCCCCAGG
GACCTGTCGAAGATTTTCGAAAGCCAGGAGCTGATCAAGTGGCGCGCCTTCCGTGAAAGCGAAGACTCGC
GCTACGTATCCCTGGTGCTGCCGCACTTCCTGCTGCGCCTGCCATACGGCCCGGACACGCTGCCGGTGGA
AGGCATCAACTACGTCGAAGACGTCAACGGCACCGACCACAGCAAATACCTGTGGGGCAACGCCGCCTGG
ACCCTGGCGCAACGCATCACCGAAGCCTTCGCCAAATATGGCTGGTGCGCAGCCATTCGCGGGGCCGAGG
GCGGTGGCGCGGTCGAAGGCCTGCCGGCCCATACGTTCCGCACCAGTTCCGGGGATCTGTCGCTCAAATG
CCCGACCGAAGTGGCAATCACCGACCGCCGTGAAAAGGAACTCAACGACCTGGGCTTCATCTCCCTGTGC
CACAAGAAAAACAGCGACGTGGCGGTGTTCTTCGGCGGCCAGACCACCAACAAGGCCAAGGCCTACAACA
CCAACGAGGCCAACGCCAACGCGCGGATCTCGGCGATGTTGCCATACGTGCTCGCGGCCTCGCGCTTCGC
CCATTACCTGAAGGTGATCATGCGTGACAAGGTCGGCAGTTTCATGACCCGCGACAACGTGCAGACCTAC
CTCAACAACTGGATCGCCGACTACGTGCTGATCAACGACAACGCGCCGCAAGAGATCAAGGCGCAGTACC
CGTTGCGCGAAGCACGGGTGGACGTGACGGAAGTGGCCGGCAAGCCAGGGGCCTACAAGGCCACGGTGTT
CCTGCGGCCGCACTTCCAGCTGGAGGAGCTGACCGCCTCGATCCGCCTGGTGGCGACCCTGCCGCCACCG
GTAGCTGCCTGA