SecReT6
Protein ID: 330810176
SecReT6 ID431
T6SS typei4a
Gene symbol-
Locus tagPSEBR_a3318
StrainPseudomonas brassicacearum subsp. brassicacearum NFM421
Repliconchromosome [GenBank: NC_015379] [Browse all T6SS(s) in this replicon]
Location [Strand]4102906..4103403 [+]
Producthemolysin co-regulated type VI secretion system effector
NoteTssD
UniProt IDF2K7P3
KEGG IDpba:PSEBR_a3318
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.90E-35, Aligned region: 10..139
Protein Sequence: 165 a.a.     [Download]
>gi|330810176|ref|YP_004354638.1| hemolysin co-regulated type VI secretion system effector [Pseudomonas brassicacearum subsp. brassicacearum NFM421]
MDAIILDLGGDIKGDSLLEGFTDKIEVMSYSHNVAMQVTNDVSNSERTSGRPHIGEFTLTKFVDSSTPTL
NEYCCAGKPIPQAVITVGRNAAEGSGKLMPFIIYTLTNVVLSNVSVSGGTGGKPVETLSLNFTKIKWELT
AQKDDGTKEGTAGTTWDLAANKMTK
 
Nucleotide Sequence: 498 bp     [Download]
>ref|NC_015379.1|:4102906-4103403 hemolysin co-regulated type VI secretion system effector [Pseudomonas brassicacearum subsp. brassicacearum NFM421]
ATGGATGCAATCATTCTCGACCTCGGCGGCGACATCAAGGGCGACAGCCTGCTGGAGGGTTTCACGGACA
AGATCGAGGTCATGTCCTACAGCCACAACGTGGCGATGCAAGTCACCAACGACGTCAGCAACTCGGAGCG
CACCTCCGGCCGACCCCACATCGGCGAGTTCACCCTGACCAAATTCGTCGACAGCTCCACCCCCACCCTC
AATGAGTATTGCTGCGCCGGCAAGCCGATCCCGCAAGCCGTCATCACCGTTGGCCGCAATGCCGCCGAGG
GCAGCGGCAAACTCATGCCGTTCATCATCTACACCCTGACCAACGTCGTGCTGTCCAACGTCAGTGTCAG
CGGCGGCACCGGCGGCAAACCGGTGGAAACCCTGTCGCTGAACTTCACCAAGATCAAATGGGAGCTCACC
GCGCAGAAAGACGACGGCACCAAGGAAGGCACGGCGGGCACGACCTGGGACCTGGCCGCCAACAAAATGA
CCAAGTAG