SecReT6
Protein ID: 330810177
SecReT6 ID431
T6SS typei4a
Gene symbol-
Locus tagPSEBR_a3319
StrainPseudomonas brassicacearum subsp. brassicacearum NFM421
Repliconchromosome [GenBank: NC_015379] [Browse all T6SS(s) in this replicon]
Location [Strand]4103417..4103860 [+]
Producthypothetical protein
NoteTssE
UniProt IDF2K7P4
KEGG IDpba:PSEBR_a3319
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 7.90E-21, Aligned region: 27..122
Protein Sequence: 147 a.a.     [Download]
>gi|330810177|ref|YP_004354639.1| hypothetical protein PSEBR_a3319 [Pseudomonas brassicacearum subsp. brassicacearum NFM421]
MAGFGLRPPLFERLASPANDTGRAFDRQALQDSVHAELSRLFNTRRGPRALTEPPSILDYGIADWTALQQ
QRSDDRRQLTREIRQAITHFEPRLRLGEVEVCPVPGHPQQLCIRLLGELRGDLHAWPVAFVIEHAGDGLE
VRHERLD
 
Nucleotide Sequence: 444 bp     [Download]
>ref|NC_015379.1|:4103417-4103860 hypothetical protein PSEBR_a3319 [Pseudomonas brassicacearum subsp. brassicacearum NFM421]
ATGGCTGGCTTCGGGCTGCGCCCGCCCCTGTTCGAACGCCTGGCCAGCCCGGCGAACGATACCGGGCGGG
CGTTCGACCGACAGGCGTTGCAAGACTCGGTGCATGCCGAACTGTCACGCCTGTTCAATACCCGACGCGG
CCCACGGGCGCTGACCGAACCGCCGAGCATCCTGGACTACGGCATCGCCGACTGGACCGCGCTGCAACAG
CAGCGCAGCGATGACCGGCGTCAACTGACCCGGGAAATCCGCCAGGCCATCACCCACTTCGAACCTCGCC
TGCGCCTGGGCGAGGTCGAGGTCTGCCCGGTGCCGGGCCATCCGCAGCAACTGTGCATACGGCTGTTGGG
TGAGCTGCGCGGCGACCTGCACGCATGGCCCGTGGCCTTTGTCATCGAGCACGCCGGCGACGGCCTTGAG
GTACGACATGAGCGACTCGATTGA