SecReT6
Protein ID: 330810179
SecReT6 ID431
T6SS typei4a
Gene symbol-
Locus tagPSEBR_a3321
StrainPseudomonas brassicacearum subsp. brassicacearum NFM421
Repliconchromosome [GenBank: NC_015379] [Browse all T6SS(s) in this replicon]
Location [Strand]4105598..4106623 [+]
Producthypothetical protein
NoteTssG
UniProt IDF2K7P6
KEGG IDpba:PSEBR_a3321
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 8.00E-82, Aligned region: 20..321
Protein Sequence: 341 a.a.     [Download]
>gi|330810179|ref|YP_004354641.1| hypothetical protein PSEBR_a3321 [Pseudomonas brassicacearum subsp. brassicacearum NFM421]
MATPSRQTPGALNLSQRLRRDPQRFEWLQALLLLEREHPQAEPLGSGTAPHAEALRLRGPLTPLFAASEV
ESLSQEPGLPPTLTTPIFGLGGPDGPLPYAYQEWLQQRARAKDHAPAEFLDLFQHRLLSLLYKVMRKHRI
AVGFTAPGASAVHAQLRALTGLLPKALQERQAAPDSAVLACTALYADGRRSLDGFAAIVREQFGLPVELT
AYEGGWREIPPASRSRLQPGGRNLCLGRNAVTGTHVWDEHAGVRLTLGPLTTGQASALLPNGEAHALLAS
LYALYFGPDLDCTLVLLIRGAGPLQLDRQAAPRLNWNGGLQRQPTLAVQRIETRLRQPEIA
 
Nucleotide Sequence: 1026 bp     [Download]
>ref|NC_015379.1|:4105598-4106623 hypothetical protein PSEBR_a3321 [Pseudomonas brassicacearum subsp. brassicacearum NFM421]
ATGGCAACCCCAAGCCGGCAAACCCCTGGTGCTCTGAACCTGAGCCAGCGCCTGCGCCGCGACCCGCAAC
GCTTCGAATGGCTCCAGGCCTTGCTGCTGCTCGAACGTGAACATCCCCAGGCCGAGCCCTTGGGCAGCGG
CACCGCGCCGCACGCCGAAGCCTTGCGTCTGCGCGGGCCCTTGACGCCGTTGTTCGCCGCCAGTGAAGTC
GAGAGCCTGAGCCAGGAACCCGGCCTGCCGCCAACCCTGACCACGCCGATCTTCGGCCTCGGCGGCCCCG
ACGGCCCGTTGCCCTACGCCTACCAGGAATGGCTGCAACAACGGGCACGGGCGAAGGACCACGCCCCGGC
GGAATTCCTCGACCTGTTCCAGCATCGCCTGCTCAGCCTGCTTTACAAGGTGATGCGCAAACATCGCATC
GCCGTGGGTTTTACCGCCCCAGGCGCGTCCGCCGTACACGCGCAACTGCGGGCGTTGACCGGCTTGCTGC
CCAAGGCCTTGCAGGAACGCCAGGCCGCCCCCGACTCGGCGGTACTGGCCTGCACCGCGCTGTACGCCGA
TGGCCGGCGCTCCCTGGATGGGTTCGCGGCGATTGTCCGTGAACAGTTCGGGCTGCCCGTGGAGCTGACC
GCCTACGAAGGTGGCTGGCGTGAAATCCCGCCAGCCAGCCGCAGCCGCTTGCAACCGGGCGGGCGCAACC
TGTGCCTGGGCCGCAACGCGGTGACCGGCACCCACGTCTGGGACGAACATGCCGGCGTGCGCCTGACCCT
CGGCCCGCTGACCACGGGCCAGGCCAGCGCACTGCTGCCCAACGGCGAAGCCCATGCGCTGCTCGCCAGT
CTCTACGCCCTGTACTTCGGCCCCGACCTGGATTGCACCCTGGTGTTGCTGATCCGTGGCGCCGGCCCAC
TGCAACTGGACCGCCAGGCAGCGCCACGGCTGAACTGGAACGGCGGCCTGCAACGCCAGCCGACCCTCGC
CGTGCAACGGATCGAAACCCGCCTTCGTCAGCCGGAGATAGCCTGA