SecReT6
Protein ID: 330810180
SecReT6 ID431
T6SS typei4a
Gene symbol-
Locus tagPSEBR_a3322
StrainPseudomonas brassicacearum subsp. brassicacearum NFM421
Repliconchromosome [GenBank: NC_015379] [Browse all T6SS(s) in this replicon]
Location [Strand]4106625..4109168 [+]
Productchaperone
NoteTssH
UniProt IDF2K7P7
KEGG IDpba:PSEBR_a3322
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 3.60E-37, Aligned region: 218..294
AAA_2 [PF07724], Evalue: 3.60E-37, Aligned region: 609..773
AAA [PF00004], Evalue: 1.60E-20, Aligned region: 218..329
AAA [PF00004], Evalue: 1.60E-20, Aligned region: 615..731
AAA_5 [PF07728], Evalue: 3.80E-15, Aligned region: 218..238
AAA_5 [PF07728], Evalue: 3.80E-15, Aligned region: 614..732
AAA_16 [PF13191], Evalue: 4.50E-12, Aligned region: 195..238
AAA_16 [PF13191], Evalue: 4.50E-12, Aligned region: 262..296
AAA_16 [PF13191], Evalue: 4.50E-12, Aligned region: 481..521
AAA_16 [PF13191], Evalue: 4.50E-12, Aligned region: 481..545
AAA_16 [PF13191], Evalue: 4.50E-12, Aligned region: 603..655
AAA_16 [PF13191], Evalue: 4.50E-12, Aligned region: 678..708
Clp_N [PF02861], Evalue: 1.30E-10, Aligned region: 21..72
Clp_N [PF02861], Evalue: 1.30E-10, Aligned region: 110..122
AAA_22 [PF13401], Evalue: 3.90E-10, Aligned region: 218..299
AAA_22 [PF13401], Evalue: 3.90E-10, Aligned region: 335..390
AAA_22 [PF13401], Evalue: 3.90E-10, Aligned region: 612..717
Zeta_toxin [PF06414], Evalue: 1.30E-06, Aligned region: 218..238
Zeta_toxin [PF06414], Evalue: 1.30E-06, Aligned region: 605..654
AAA_17 [PF13207], Evalue: 1.80E-06, Aligned region: 218..267
AAA_17 [PF13207], Evalue: 1.80E-06, Aligned region: 498..498
AAA_17 [PF13207], Evalue: 1.80E-06, Aligned region: 613..651
AAA_14 [PF13173], Evalue: 3.00E-06, Aligned region: 218..298
AAA_14 [PF13173], Evalue: 3.00E-06, Aligned region: 580..597
AAA_14 [PF13173], Evalue: 3.00E-06, Aligned region: 613..703
AAA_25 [PF13481], Evalue: 1.40E-05, Aligned region: 218..242
AAA_25 [PF13481], Evalue: 1.40E-05, Aligned region: 272..315
AAA_25 [PF13481], Evalue: 1.40E-05, Aligned region: 456..521
AAA_25 [PF13481], Evalue: 1.40E-05, Aligned region: 612..639
IstB_IS21 [PF01695], Evalue: 2.80E-05, Aligned region: 212..237
IstB_IS21 [PF01695], Evalue: 2.80E-05, Aligned region: 614..634
FtsK_SpoIIIE [PF01580], Evalue: 5.60E-05, Aligned region: 211..259
FtsK_SpoIIIE [PF01580], Evalue: 5.60E-05, Aligned region: 431..513
FtsK_SpoIIIE [PF01580], Evalue: 5.60E-05, Aligned region: 614..635
Sigma54_activat [PF00158], Evalue: 7.00E-05, Aligned region: 218..233
Sigma54_activat [PF00158], Evalue: 7.00E-05, Aligned region: 613..713
ClpB_D2-small [PF10431], Evalue: 7.20E-05, Aligned region: 779..846
AAA_19 [PF13245], Evalue: 9.50E-05, Aligned region: 215..240
AAA_19 [PF13245], Evalue: 9.50E-05, Aligned region: 585..599
AAA_19 [PF13245], Evalue: 9.50E-05, Aligned region: 612..636
AAA_19 [PF13245], Evalue: 9.50E-05, Aligned region: 756..772
AAA_18 [PF13238], Evalue: 0.00022, Aligned region: 218..238
AAA_18 [PF13238], Evalue: 0.00022, Aligned region: 615..649
AAA_28 [PF13521], Evalue: 0.00023, Aligned region: 218..293
AAA_28 [PF13521], Evalue: 0.00023, Aligned region: 614..634
ResIII [PF04851], Evalue: 0.0003, Aligned region: 209..238
ResIII [PF04851], Evalue: 0.0003, Aligned region: 284..299
ResIII [PF04851], Evalue: 0.0003, Aligned region: 589..636
NACHT [PF05729], Evalue: 0.00049, Aligned region: 218..245
NACHT [PF05729], Evalue: 0.00049, Aligned region: 614..639
RNA_helicase [PF00910], Evalue: 0.0013, Aligned region: 219..239
RNA_helicase [PF00910], Evalue: 0.0013, Aligned region: 615..636
AAA_29 [PF13555], Evalue: 0.0015, Aligned region: 210..234
AAA_29 [PF13555], Evalue: 0.0015, Aligned region: 610..639
AAA_23 [PF13476], Evalue: 0.0016, Aligned region: 218..235
AAA_23 [PF13476], Evalue: 0.0016, Aligned region: 478..517
AAA_23 [PF13476], Evalue: 0.0016, Aligned region: 612..640
T2SE [PF00437], Evalue: 0.0016, Aligned region: 204..234
T2SE [PF00437], Evalue: 0.0016, Aligned region: 598..683
SRP54 [PF00448], Evalue: 0.0017, Aligned region: 218..238
SRP54 [PF00448], Evalue: 0.0017, Aligned region: 613..643
Arch_ATPase [PF01637], Evalue: 0.0028, Aligned region: 196..232
Arch_ATPase [PF01637], Evalue: 0.0028, Aligned region: 270..304
Arch_ATPase [PF01637], Evalue: 0.0028, Aligned region: 613..655
Arch_ATPase [PF01637], Evalue: 0.0028, Aligned region: 681..709
AAA_33 [PF13671], Evalue: 0.0041, Aligned region: 218..235
AAA_33 [PF13671], Evalue: 0.0041, Aligned region: 613..635
Protein Sequence: 847 a.a.     [Download]
>gi|330810180|ref|YP_004354642.1| chaperone [Pseudomonas brassicacearum subsp. brassicacearum NFM421]
MELASLIGRLNPDNRRALERAAQRCMQRSHHYVEIEHLLLELLDIEGGDFACLLPRFGLERDAVATETNK
ALDLFKSGSTRTPALSAQTIGLLEDAVVQASVLGLDSIRSGLLLLALLDRDERRSLLLNSASSLLRIPRD
ALRAHLLEWTESSREHAGGVRPAKPGEVPQKQDPVLDQYTQDLTADARAGRIDPIVGRDGEIRQCIDILL
RRRQNNPILVGAPGVGKTAVVEGLALRIAAGDVPPSLQEVTLRVLDLGLLQAGAGVKGEFEQRLKGVIDA
VRSAEKPIILFIDEAHTLIGAGGAEGGSDAANLLKPALARGELRTLAATTWLEYKKYFEKDPALARRFQL
VQVEEPDELTAVEMLRGVASKLEQHHGVQVLDAAIHEAVKLSHRYISGRQLPDKAISVLDTACARVALGQ
HDVPPPLESLRHRQNSLKDEVERLRREQATGLDHRERITLLEDESTSNVQAIRELETRWGEEREAVRELL
DTRRELLALSERADSEKADTEIDNRIDHLAAELLRLEAGLDAIRQDDPLVPEQVDSKTVAAVIAGWTGIP
VGKMLADEAHAVRTLGQRMGQRVMGQSTALNTIAQRLQAYRAGLTDPQKPVGVFLLVGPTGVGKTETAYA
LADALYGGERNLISINLSEYQEAHTVSQLKGAPPGYVGYGSGGVLTEAVRRKPYSVVLLDEIEKAHPDVL
EAFYNVFDKGLMEDGTGLVVDFKNTVMLATSNVGAELLLDTPAAQLGSDAFNEALHKVLLQAFRPAFLAR
MTVVAYRPLDEATLEGIVLAKLEKLRGRYKAATGKQFEFDAGIVKAVLAKCSAAGARDVENVLMTQVTGK
LAEWVLE
 
Nucleotide Sequence: 2544 bp     [Download]
>ref|NC_015379.1|:4106625-4109168 chaperone [Pseudomonas brassicacearum subsp. brassicacearum NFM421]
ATGGAACTGGCCAGCCTGATCGGACGCCTCAACCCGGACAACCGCCGCGCCCTGGAACGGGCCGCGCAAC
GTTGCATGCAGCGCAGCCATCATTACGTGGAAATCGAACACCTGCTGTTGGAGTTGCTCGACATCGAGGG
CGGTGATTTTGCCTGCCTGCTGCCACGATTCGGTCTGGAGCGTGACGCGGTGGCGACGGAAACCAACAAG
GCCCTGGACCTGTTCAAATCCGGCAGCACCCGCACACCCGCCCTGTCGGCACAAACCATCGGCCTGCTGG
AAGACGCCGTGGTCCAGGCCAGCGTGCTGGGCCTGGACAGCATCCGCTCCGGGCTGTTGCTGCTGGCGCT
GCTGGACCGCGATGAGCGCCGCAGCCTGCTGCTCAACAGCGCCTCGTCGTTGCTGCGCATTCCTCGCGAC
GCCCTGCGCGCCCACCTATTGGAATGGACCGAAAGCTCCCGCGAGCATGCCGGTGGCGTGCGCCCGGCCA
AACCCGGCGAGGTGCCACAGAAACAGGACCCGGTGCTGGACCAGTACACCCAGGACCTGACCGCCGACGC
CCGGGCCGGGCGCATCGACCCCATCGTCGGCCGCGACGGCGAGATCCGCCAGTGCATCGACATTCTGCTC
CGGCGCCGGCAGAACAACCCGATCCTGGTGGGCGCACCAGGCGTCGGCAAGACCGCAGTGGTGGAAGGCC
TGGCCCTGCGTATCGCCGCCGGGGATGTGCCGCCGTCGTTGCAGGAAGTCACCCTGCGTGTCCTCGACCT
GGGCCTGTTGCAGGCCGGTGCCGGTGTCAAAGGTGAATTCGAACAACGCCTCAAAGGCGTGATCGACGCG
GTACGCAGTGCCGAAAAACCGATCATCCTGTTCATCGACGAAGCCCATACGCTGATCGGTGCCGGCGGCG
CGGAAGGCGGCAGCGACGCGGCCAACCTGCTCAAGCCGGCCCTGGCCCGGGGCGAACTGCGCACCCTGGC
CGCCACCACCTGGCTGGAGTACAAAAAATATTTCGAGAAAGACCCGGCCCTGGCCCGCCGCTTCCAACTG
GTGCAGGTCGAAGAACCGGACGAACTTACCGCGGTGGAAATGCTCCGCGGCGTGGCGAGCAAACTGGAAC
AGCACCACGGCGTGCAGGTGCTGGACGCGGCCATCCACGAGGCGGTGAAGCTGTCCCACCGCTACATCTC
CGGGCGACAGTTGCCGGACAAAGCCATCAGCGTGCTCGACACCGCCTGCGCCCGGGTCGCCCTCGGCCAG
CACGACGTGCCGCCGCCGTTGGAAAGCCTGCGCCATCGGCAGAACAGCCTCAAGGACGAGGTCGAACGCC
TGCGCCGGGAACAGGCCACCGGGCTCGATCACCGCGAGCGCATCACTCTGCTCGAAGACGAATCGACCAG
CAATGTGCAGGCCATCCGCGAGCTGGAAACTCGCTGGGGCGAAGAGCGCGAAGCCGTGCGCGAACTGCTC
GACACCCGGCGCGAACTGCTTGCCCTGAGCGAACGCGCCGACAGTGAAAAAGCCGACACCGAGATCGATA
ACCGCATCGACCACCTGGCCGCCGAACTGCTGCGCCTGGAAGCTGGCCTGGATGCCATTCGCCAGGACGA
TCCGCTGGTGCCCGAACAGGTGGACAGCAAGACCGTCGCCGCCGTGATCGCCGGCTGGACCGGCATCCCG
GTGGGCAAGATGCTCGCCGACGAAGCCCACGCCGTGCGCACCCTCGGCCAGCGCATGGGCCAGCGGGTCA
TGGGCCAGAGCACCGCGTTGAACACCATCGCCCAACGCCTGCAAGCCTACCGCGCCGGCCTCACCGACCC
ACAGAAACCGGTCGGCGTATTCCTGCTGGTGGGCCCCACCGGCGTGGGCAAGACCGAAACCGCCTACGCC
CTGGCCGACGCCTTGTACGGAGGTGAACGCAACCTGATCAGCATCAACCTCTCGGAGTACCAGGAAGCCC
ACACCGTCAGCCAACTCAAAGGCGCCCCACCCGGCTACGTCGGCTACGGCAGCGGCGGCGTGCTCACCGA
AGCGGTGCGGCGCAAACCCTATTCGGTGGTGCTGCTGGATGAAATCGAAAAGGCCCACCCGGATGTGCTC
GAAGCCTTCTACAACGTCTTCGACAAAGGCCTGATGGAAGATGGCACCGGCCTGGTGGTGGACTTCAAGA
ACACCGTGATGCTCGCCACCAGCAACGTCGGCGCCGAGCTATTGCTGGATACGCCCGCCGCGCAACTGGG
CAGCGACGCCTTCAACGAAGCCTTGCACAAGGTGCTGCTGCAAGCATTCCGCCCGGCGTTTTTGGCGCGC
ATGACCGTGGTGGCATACCGGCCGCTGGATGAAGCGACACTGGAGGGGATCGTGCTGGCGAAGCTGGAAA
AACTGCGCGGGCGCTACAAGGCTGCGACGGGCAAGCAGTTCGAGTTCGATGCCGGAATCGTCAAGGCTGT
GTTGGCCAAATGCAGCGCGGCGGGGGCACGGGACGTCGAGAATGTGTTGATGACGCAAGTGACAGGGAAG
TTGGCGGAGTGGGTGTTGGAATAG