SecReT6
Protein ID: 330810182
SecReT6 ID431
T6SS typei4a
Gene symbol-
Locus tagPSEBR_a3324
StrainPseudomonas brassicacearum subsp. brassicacearum NFM421
Repliconchromosome [GenBank: NC_015379] [Browse all T6SS(s) in this replicon]
Location [Strand]4110075..4112084 [+]
Producttype VI secretion system, Vgr family
NoteTssI
UniProt IDF2K7P9
KEGG IDpba:PSEBR_a3324
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 5.30E-67, Aligned region: 45..324
Phage_base_V [PF04717], Evalue: 1.90E-22, Aligned region: 352..445
Gp5_C [PF06715], Evalue: 1.20E-11, Aligned region: 489..501
Gp5_C [PF06715], Evalue: 1.20E-11, Aligned region: 502..524
Gp5_C [PF06715], Evalue: 1.20E-11, Aligned region: 537..558
Gp5_C [PF06715], Evalue: 1.20E-11, Aligned region: 561..584
Gp5_C [PF06715], Evalue: 1.20E-11, Aligned region: 648..655
Protein Sequence: 669 a.a.     [Download]
>gi|330810182|ref|YP_004354644.1| type VI secretion system, Vgr family [Pseudomonas brassicacearum subsp. brassicacearum NFM421]
MPRTTDSNTTLSLTATSLSALYPESLSGEESLNALGSHILNGINDGASLTLTTAVASHVTTTLHKDALLR
PLDLLVAEIRQLPADATAERYQLLLRPWLWWLSLASNNRVFQNLATSDIVTTIFKAHGFTDFQLKLTGSY
TPREYCVQYGETDLAFVSRLLEEDGIFWFFTHEEGTHTLVLADSNDAFAPIPNGPTVNYLGQIIGERELH
GIRSGQVCLQAVAGVYQATDYEFTTPTTSLYSQAEAVAGPSSMYEHPGGYTAKAQGDALTKQRVDGLRSQ
EKRFVGESDCRWLVPGYWFTLAGHEDTTLNIDWVVTSVSHEASHDSYRNRFEAIPKATAYRPPRVTAKPR
MHTQTALVVGKAGEEILTDEYGRIKLQFPWDRTGKNDETSSCWVRVVLPWSGKGFGMQFVPRIGQEVIVT
FIDGDPDRPLVTGCVYNGDNALPYALPANQTQSGIKTNSSKGGGGFNELRFEDKKDAEEVFLQAQKDFNI
NVLNDTTATVGHDETLTVQNARTRTVKDGDETVTLEKGKRSVTIQTGSDSLDVKDTRTVTVGSDQTHSTG
GNYEHKVTGNYSLTVDGNLTIKVSGTLTLQSGGSFAIKSGADLAAQASTSISQKAGTALSNQAGTSLENK
AGTTLTNDAGISLVNKAAAEQTVDGGGMLTIKGGLVKVN
 
Nucleotide Sequence: 2010 bp     [Download]
>ref|NC_015379.1|:4110075-4112084 type VI secretion system, Vgr family [Pseudomonas brassicacearum subsp. brassicacearum NFM421]
ATGCCCCGCACCACTGACAGCAACACCACCCTCTCCCTGACCGCCACTTCCCTGTCGGCGCTGTACCCCG
AATCGCTATCGGGCGAAGAAAGCCTCAACGCATTGGGCTCGCACATCCTCAACGGTATCAACGACGGCGC
CTCGTTAACCCTCACCACCGCCGTTGCCAGTCACGTCACCACGACCCTGCACAAGGACGCGCTGCTGCGC
CCGTTGGACTTGCTGGTCGCGGAAATCCGCCAGCTCCCCGCCGACGCCACCGCCGAGCGCTATCAACTCC
TGCTCCGGCCCTGGCTCTGGTGGCTGAGCCTGGCCAGCAACAACCGCGTATTCCAGAACCTCGCCACCTC
GGACATCGTCACCACGATTTTCAAGGCCCATGGTTTCACCGACTTCCAGCTCAAACTCACCGGCAGCTAC
ACCCCGCGCGAATACTGCGTGCAATATGGCGAGACCGACCTGGCCTTCGTCTCGCGCCTGCTGGAAGAAG
ACGGGATCTTCTGGTTCTTCACCCATGAGGAAGGCACCCACACGCTGGTCCTGGCCGACAGCAACGACGC
TTTCGCACCGATTCCCAACGGGCCGACGGTGAACTACCTCGGGCAGATAATCGGCGAGCGGGAACTGCAT
GGCATCCGCTCCGGGCAAGTGTGCCTGCAAGCGGTGGCCGGGGTTTACCAGGCAACCGACTATGAGTTCA
CCACGCCGACGACATCGCTCTACAGCCAGGCCGAAGCCGTGGCCGGGCCAAGCTCGATGTACGAACATCC
CGGCGGCTACACCGCCAAGGCCCAGGGCGATGCGTTGACCAAGCAGCGGGTGGACGGCCTGCGCAGCCAG
GAGAAACGTTTTGTCGGCGAAAGCGATTGCCGCTGGCTGGTGCCAGGGTATTGGTTCACCCTCGCCGGCC
ACGAAGACACGACGCTGAATATCGATTGGGTCGTGACCTCGGTCAGCCACGAAGCCAGCCACGACAGCTA
TCGCAACCGCTTCGAAGCGATCCCCAAGGCCACGGCCTATCGACCGCCCCGCGTCACGGCAAAACCGCGC
ATGCACACCCAGACGGCGCTGGTGGTGGGCAAGGCCGGCGAAGAAATCTTGACCGATGAATATGGCCGGA
TCAAATTGCAGTTCCCCTGGGACCGCACCGGCAAGAACGACGAGACCTCATCCTGTTGGGTCCGCGTGGT
CTTGCCCTGGAGCGGCAAAGGCTTTGGCATGCAGTTCGTACCGCGCATCGGCCAGGAAGTCATCGTGACC
TTCATCGACGGCGACCCGGACCGTCCCCTGGTCACCGGCTGCGTCTACAACGGCGACAACGCCCTGCCCT
ACGCACTGCCGGCGAACCAGACCCAGTCCGGGATCAAGACCAATTCGTCCAAGGGCGGCGGCGGTTTCAA
CGAGTTGCGTTTCGAAGACAAGAAGGACGCCGAAGAGGTGTTTCTCCAGGCCCAGAAAGACTTCAACATC
AACGTGCTCAACGACACCACCGCCACCGTCGGCCACGACGAAACCCTCACGGTGCAGAACGCCCGCACCC
GCACGGTGAAGGATGGCGACGAAACCGTGACCCTGGAGAAAGGCAAGCGCAGCGTGACCATCCAGACCGG
CAGCGACAGCCTTGATGTGAAGGACACCCGCACCGTCACCGTGGGCTCGGACCAGACCCACAGCACCGGC
GGCAACTACGAGCACAAGGTCACCGGCAATTACAGCCTGACGGTGGACGGCAACCTGACCATCAAGGTCA
GCGGCACCCTGACCCTGCAAAGCGGCGGCAGCTTCGCGATCAAGAGCGGCGCCGACCTGGCCGCCCAGGC
CAGCACGTCCATCAGCCAGAAAGCCGGCACAGCCCTGAGCAACCAGGCCGGTACCTCGCTGGAAAACAAG
GCCGGCACCACCCTGACCAACGACGCCGGCATCAGCTTGGTGAACAAGGCCGCGGCCGAACAGACCGTGG
ACGGCGGCGGCATGCTGACCATCAAGGGCGGCCTGGTGAAGGTCAACTGA