SecReT6
Protein ID: 330812623
SecReT6 ID432
T6SS typei3
Gene symbol-
Locus tagPSEBR_a5551
StrainPseudomonas brassicacearum subsp. brassicacearum NFM421
Repliconchromosome [GenBank: NC_015379] [Browse all T6SS(s) in this replicon]
Location [Strand]6691749..6692402 [-]
Producthypothetical protein
NoteTagF
UniProt IDF2K704
KEGG IDpba:PSEBR_a5551
PDB IDNA
Domain hit(s) vs Pfam DUF2094 [PF09867], Evalue: 4.70E-49, Aligned region: 5..142
Protein Sequence: 217 a.a.     [Download]
>gi|330812623|ref|YP_004357085.1| hypothetical protein PSEBR_a5551 [Pseudomonas brassicacearum subsp. brassicacearum NFM421]
MRTPGFYGKLASRGDFVSRGLPQSFIGPWDSWLAAGLLASQTSLGERWLDAYLVSPLWRFMVAPGVCGPD
AAVGVVMPSIDRVGRYFPLTVAMLLEPDADPASVVGGADEWFERVENLLLSTLSVEASFEAFNEQLETLG
SPMYLPRTPSSRFASLHRFDATDPQRRMSALAEAACEGASLWWGQGSERIAPGLMRCQGLPAAADFAQFL
LGQEGVV
 
Nucleotide Sequence: 654 bp     [Download]
>ref|NC_015379.1|:c6692402-6691749 hypothetical protein PSEBR_a5551 [Pseudomonas brassicacearum subsp. brassicacearum NFM421]
ATGAGGACACCGGGCTTCTATGGAAAGTTGGCCAGCCGCGGCGATTTCGTCAGCCGTGGCTTGCCTCAGA
GTTTTATCGGCCCGTGGGATTCGTGGTTGGCGGCGGGTTTGCTCGCCAGCCAGACCAGCCTCGGCGAGCG
CTGGCTGGACGCCTATCTGGTCAGCCCGCTGTGGCGCTTCATGGTCGCACCGGGTGTGTGTGGCCCGGAC
GCCGCGGTCGGCGTGGTGATGCCGAGCATTGACCGGGTCGGCCGTTATTTCCCGCTGACTGTCGCGATGT
TGCTGGAGCCCGACGCGGACCCGGCGTCGGTGGTGGGCGGTGCGGACGAGTGGTTTGAGCGGGTCGAGAA
CCTGTTGCTGAGCACGTTGAGTGTGGAGGCCAGTTTCGAGGCGTTCAACGAACAGCTGGAGACCCTGGGC
AGCCCGATGTACCTGCCGCGCACGCCGAGCAGCCGCTTTGCCAGCCTGCATCGCTTCGATGCCACTGACC
CGCAACGGCGCATGAGCGCCCTCGCCGAGGCAGCCTGCGAAGGCGCGAGCCTGTGGTGGGGCCAGGGATC
GGAGCGCATTGCCCCGGGGTTGATGCGCTGCCAGGGACTGCCGGCGGCGGCTGATTTTGCGCAATTTTTG
CTCGGCCAAGAAGGTGTTGTGTAG