SecReT6
Protein ID: 330812625
SecReT6 ID432
T6SS typei3
Gene symbol-
Locus tagPSEBR_a5553
StrainPseudomonas brassicacearum subsp. brassicacearum NFM421
Repliconchromosome [GenBank: NC_015379] [Browse all T6SS(s) in this replicon]
Location [Strand]6695896..6697206 [-]
Producthypothetical protein
NoteTssL
UniProt IDF2K706
KEGG IDpba:PSEBR_a5553
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 5.10E-70, Aligned region: 53..258
OmpA [PF00691], Evalue: 1.10E-16, Aligned region: 326..424
DUF883 [PF05957], Evalue: 0.0068, Aligned region: 78..101
DUF883 [PF05957], Evalue: 0.0068, Aligned region: 188..254
DUF883 [PF05957], Evalue: 0.0068, Aligned region: 325..354
Protein Sequence: 436 a.a.     [Download]
>gi|330812625|ref|YP_004357087.1| hypothetical protein PSEBR_a5553 [Pseudomonas brassicacearum subsp. brassicacearum NFM421]
MSNDDRTQFMPTPGGRGGDPFRPDAGRPQPTPAPAPLSMPAAPVLTGKAEGLNPLESAAGPLLALLTRLR
NTIAHPAPASLRAQLLAYLRQFEERAEAAGVVRNDVLLARYALCTALDEAVLSTPWGGTSDWGKQSLLIT
VHNEAWGGEKVFQLLEHCLQSPRERLYLLELLYLCMCLGFEGRYRVMNDGRSQLEALRERTAAVIRSARG
DYERELSPHWRGVTVARDRLAQFMPPWIAVAIGAALLLALLFGLRMKLASDAEPVFKNIHFLGEIPVQTI
DRPVVQPKVIERPRLAGFLADEIRANRIAVEDAVDRSVVTIRGDELFASGSASIKDDFQPLMLRIADAVR
KVKGQVLVTGHSDNRPIATLRFPSNWALSEARAQSVLQILSAKTGQPERFSAEGRSDTEPLASNATTEGR
ARNRRVEITVLAEGVE
 
Nucleotide Sequence: 1311 bp     [Download]
>ref|NC_015379.1|:c6697206-6695896 hypothetical protein PSEBR_a5553 [Pseudomonas brassicacearum subsp. brassicacearum NFM421]
ATGAGTAACGACGATCGTACCCAGTTCATGCCGACGCCCGGTGGCCGTGGTGGAGATCCCTTCCGCCCGG
ACGCTGGCCGGCCACAGCCGACGCCTGCGCCTGCACCGCTGTCGATGCCGGCCGCGCCGGTGCTGACCGG
CAAGGCCGAGGGGCTCAACCCGCTGGAAAGCGCCGCCGGCCCGCTGCTGGCGCTGCTGACGCGCCTGCGC
AACACCATTGCCCACCCGGCGCCGGCCAGTCTGCGCGCACAACTGCTGGCCTACCTGCGCCAGTTCGAAG
AGCGTGCCGAGGCCGCCGGTGTGGTACGCAACGATGTGTTGCTGGCCCGCTACGCCTTGTGTACCGCGCT
GGACGAAGCGGTGTTGAGCACGCCGTGGGGCGGCACCAGCGATTGGGGCAAGCAGAGCCTGTTGATCACC
GTGCACAACGAAGCCTGGGGCGGTGAGAAGGTGTTCCAGTTGCTGGAGCATTGCCTGCAAAGCCCGCGCG
AGCGCCTGTATCTGCTGGAGCTTTTGTATCTGTGCATGTGCCTGGGTTTCGAAGGGCGCTATCGGGTGAT
GAACGACGGTCGCAGCCAACTGGAAGCGTTGCGTGAGCGCACCGCCGCCGTCATCCGCAGCGCCCGTGGC
GACTACGAGCGCGAGCTGTCGCCGCACTGGCGCGGTGTCACTGTGGCCCGTGATCGACTGGCGCAATTCA
TGCCGCCATGGATCGCCGTGGCCATCGGTGCGGCGCTGTTGCTGGCGCTGCTGTTCGGCCTGCGCATGAA
GCTGGCCTCCGATGCCGAGCCGGTGTTCAAGAACATTCATTTCCTCGGTGAAATCCCGGTGCAGACCATC
GACCGCCCTGTGGTACAACCGAAGGTGATCGAGCGCCCACGCCTGGCCGGTTTCCTCGCCGATGAAATCC
GCGCCAACCGCATTGCCGTGGAAGACGCCGTCGACCGCTCGGTGGTGACCATCCGCGGCGATGAGCTGTT
CGCCTCGGGCAGCGCCAGCATCAAGGACGATTTCCAGCCGCTGATGCTGCGCATCGCCGATGCGGTGCGC
AAGGTCAAGGGCCAGGTCCTGGTCACCGGGCACAGCGATAATCGGCCGATCGCCACCCTCCGGTTCCCGT
CCAACTGGGCGTTGTCCGAAGCGCGGGCGCAATCGGTGCTGCAAATTCTCTCGGCCAAGACTGGCCAGCC
CGAGCGCTTCAGCGCCGAAGGCCGCAGCGACACCGAGCCGTTGGCATCCAACGCCACCACAGAGGGGCGT
GCGCGCAACCGTCGGGTTGAAATCACAGTATTGGCGGAGGGGGTCGAGTGA