SecReT6
Protein ID: 330812626
SecReT6 ID432
T6SS typei3
Gene symbol-
Locus tagPSEBR_a5554
StrainPseudomonas brassicacearum subsp. brassicacearum NFM421
Repliconchromosome [GenBank: NC_015379] [Browse all T6SS(s) in this replicon]
Location [Strand]6697213..6698547 [-]
Producthypothetical protein
NoteTssK
UniProt IDF2K707
KEGG IDpba:PSEBR_a5554
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.70E-155, Aligned region: 19..443
Protein Sequence: 444 a.a.     [Download]
>gi|330812626|ref|YP_004357088.1| hypothetical protein PSEBR_a5554 [Pseudomonas brassicacearum subsp. brassicacearum NFM421]
MSWNNRVVWSEGMFIGTQHFQQHDRYLENLIDARSRPLSAGAWGFSELLIDQGLLAQGKLAIISARGLLP
DGTPFNIPQDDLAPTPLNVDDNLRDGLVYLALPLKRAGARDTVDEGEDLGAARYVSQVCEVRDDNAPFEN
RAPVALGSRALRLLTEQDGIGDYAAIGVVRIKEKRADRALVLDDAYIPPLLDVIASKPLAAFRSELLGLL
HQRGEALAGRVVASGAGGASEIADFMLLQLVNRAQPLIQHLSQLSPLHPERFYSELVSLAGEFSTFTASG
RRPQQYPPYQHDDLALSYAPVMQALREALSMLIDSKATPIPIVEKAYGIHVAMLADKTLLDSASFILVVR
ADVPAETLRGRFGQQSKVGSVEHIRDLVNLQLPGIGLLPLPVAPRQLPYHAGSTYYELDRGSDHWQQLSN
SGGFAFHIAGQFPGLNLAFWAIRG
 
Nucleotide Sequence: 1335 bp     [Download]
>ref|NC_015379.1|:c6698547-6697213 hypothetical protein PSEBR_a5554 [Pseudomonas brassicacearum subsp. brassicacearum NFM421]
ATGTCCTGGAACAATCGCGTGGTCTGGTCGGAAGGCATGTTCATTGGAACGCAGCACTTCCAACAGCATG
ACCGTTACCTGGAAAACCTCATCGACGCACGCAGCCGCCCGTTGTCGGCCGGCGCCTGGGGTTTTTCCGA
ATTGCTGATCGACCAGGGCCTGCTGGCCCAGGGCAAGCTGGCGATCATCTCGGCGCGCGGCCTGTTGCCG
GACGGTACGCCCTTCAACATTCCCCAGGATGACCTGGCACCAACCCCGCTGAACGTCGACGACAACCTGC
GCGATGGCCTGGTGTACCTGGCCTTGCCGCTCAAGCGCGCCGGCGCCCGGGACACCGTGGACGAAGGCGA
AGACCTCGGCGCTGCGCGTTATGTGAGCCAGGTGTGCGAAGTGCGTGACGACAACGCACCGTTCGAAAAC
CGCGCACCGGTGGCCCTCGGCTCACGGGCGCTGCGGCTGTTGACCGAACAGGATGGCATCGGCGACTACG
CCGCCATCGGCGTGGTTCGCATCAAGGAAAAGCGCGCCGACCGTGCATTGGTACTCGACGACGCCTACAT
CCCGCCGCTGTTGGATGTGATCGCCTCCAAGCCACTGGCGGCGTTTCGCAGCGAACTGCTGGGCCTGCTG
CATCAACGCGGCGAAGCCCTGGCCGGGCGGGTAGTGGCGTCCGGCGCCGGTGGCGCCTCGGAAATTGCCG
ATTTCATGCTGTTGCAACTGGTCAACCGCGCCCAGCCGCTGATCCAGCACCTGAGCCAGTTGAGCCCGCT
GCATCCCGAGCGTTTCTACAGCGAGCTGGTGAGCCTGGCCGGGGAGTTCTCCACGTTCACCGCGTCCGGG
CGCCGACCGCAGCAATACCCGCCTTACCAGCACGATGACCTGGCGCTCAGCTACGCGCCCGTGATGCAGG
CCCTGCGCGAAGCCCTGTCGATGCTGATCGACAGCAAGGCGACGCCAATTCCGATTGTCGAGAAAGCCTA
CGGCATCCACGTGGCGATGCTGGCCGACAAGACCCTGCTCGACAGTGCCAGTTTCATCCTGGTGGTGCGC
GCCGACGTGCCGGCCGAGACCCTGCGTGGCCGCTTCGGCCAGCAGAGCAAGGTCGGTTCGGTGGAGCACA
TCCGCGACCTGGTCAACCTGCAACTGCCGGGCATCGGCCTGCTGCCGTTGCCGGTGGCGCCACGGCAGTT
GCCGTACCACGCCGGCTCCACTTACTACGAGCTCGACCGGGGCAGCGATCACTGGCAGCAACTGAGCAAC
TCCGGCGGCTTTGCGTTCCACATCGCCGGCCAGTTCCCAGGGCTGAACCTGGCCTTCTGGGCGATCCGAG
GATAA