SecReT6
Protein ID: 330812627
SecReT6 ID432
T6SS typei3
Gene symbol-
Locus tagPSEBR_a5555
StrainPseudomonas brassicacearum subsp. brassicacearum NFM421
Repliconchromosome [GenBank: NC_015379] [Browse all T6SS(s) in this replicon]
Location [Strand]6698563..6699069 [-]
Producthypothetical protein
NoteTssJ
UniProt IDF2K708
KEGG IDpba:PSEBR_a5555
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.30E-40, Aligned region: 12..153
Protein Sequence: 168 a.a.     [Download]
>gi|330812627|ref|YP_004357089.1| hypothetical protein PSEBR_a5555 [Pseudomonas brassicacearum subsp. brassicacearum NFM421]
MIPRFLLAVATVLLLTACAKDAANPQPEEAEADTAAIELHFHAIAGLNPGATGQPAPVRVRIFELKNAAT
FGRADYFALAERAQATLGADLIDQDEVLIQPGQQLSLQRDLDPATRHIGILVGYRELDQSLWRTVMNVPA
REYTEYQISLDVRAVRSAVVVPPSSPAQ
 
Nucleotide Sequence: 507 bp     [Download]
>ref|NC_015379.1|:c6699069-6698563 hypothetical protein PSEBR_a5555 [Pseudomonas brassicacearum subsp. brassicacearum NFM421]
ATGATTCCCAGGTTTTTACTCGCAGTCGCCACCGTGCTTCTGCTGACGGCGTGCGCCAAGGATGCGGCCA
ACCCCCAGCCCGAAGAAGCTGAGGCCGACACCGCCGCCATCGAGCTGCACTTTCACGCCATTGCCGGCCT
CAACCCCGGCGCCACCGGCCAGCCGGCCCCGGTCCGGGTGCGCATTTTCGAACTGAAAAATGCCGCGACC
TTCGGCCGTGCCGATTATTTCGCCCTCGCCGAACGGGCCCAGGCAACGCTGGGCGCCGACCTGATCGACC
AGGACGAGGTGCTGATCCAGCCCGGCCAGCAACTGAGCCTGCAACGCGACCTCGACCCGGCCACGCGGCA
TATCGGAATACTGGTGGGCTATCGCGAGCTGGACCAGTCGCTGTGGCGCACGGTGATGAACGTCCCGGCG
CGCGAATACACCGAATACCAGATCAGCCTCGATGTGCGCGCCGTGCGCAGCGCCGTCGTCGTCCCCCCAT
CCAGCCCTGCCCAATAA