SecReT6
Protein ID: 330812628
SecReT6 ID432
T6SS typei3
Gene symbol-
Locus tagPSEBR_a5556
StrainPseudomonas brassicacearum subsp. brassicacearum NFM421
Repliconchromosome [GenBank: NC_015379] [Browse all T6SS(s) in this replicon]
Location [Strand]6699138..6700679 [-]
Producthypothetical protein
NoteFha
UniProt IDF2K709
KEGG IDpba:PSEBR_a5556
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 4.00E-17, Aligned region: 30..97
Protein Sequence: 513 a.a.     [Download]
>gi|330812628|ref|YP_004357090.1| hypothetical protein PSEBR_a5556 [Pseudomonas brassicacearum subsp. brassicacearum NFM421]
MPLCLTITSYHKITPGQCSEKSMDQGVMAIGRNSDNDWVLPDPERLVSGKHCVIQYKDGRYYLTDNSTNG
VELVKAGVRLRKGNSEPLQDGEVIRIGDYEIQARVDFSLPVTDSNPFAESPSSFEALMGRQGAAVHTPSP
LHTPSPIQAAPPAHFQGGSAMDTLPDLFDFLTPASVPPATQPDHVPAEQHNFRPPTPIPRPSPPPVVEPV
IPPSASVIPDDWDPFSDKPVPVAVAPQPVAPQPVPLPPVVEPVASPVPQAPLVDIFAEISAPPPAPVPEA
SVTRVEPPVAPPVAPVAQVASVAPVAPVAPVTPIEANQPDLLQAFLRGAGLDQLRLDKANAEAQMESIGR
SYRLMVEGLIDVLRARSSLKGEFRIQQTMIQPVENNPLKFAPNVDEALLLLLRHGNQAFMAPDAAVRDSF
DDLRAHQLAVMAGVEAAIKHLLGRFEPAQLEERMAKPGGLSGIFSGSRQAQYWQQFTELYSNISREAQED
FQDLFGREFSRAYEEHSTRQRRR
 
Nucleotide Sequence: 1542 bp     [Download]
>ref|NC_015379.1|:c6700679-6699138 hypothetical protein PSEBR_a5556 [Pseudomonas brassicacearum subsp. brassicacearum NFM421]
ATGCCGCTGTGTTTGACTATCACTAGTTATCACAAGATCACCCCAGGCCAGTGTTCTGAAAAGTCCATGG
ATCAGGGGGTGATGGCAATTGGCCGTAATTCCGATAATGACTGGGTATTGCCGGACCCTGAGCGCCTGGT
TTCCGGCAAACATTGCGTTATCCAATACAAAGACGGGCGTTATTATTTAACTGATAACAGTACTAATGGT
GTGGAATTGGTCAAGGCCGGTGTTCGCCTGCGCAAGGGCAACAGCGAACCCCTGCAAGACGGCGAAGTGA
TCCGCATCGGTGATTATGAGATCCAGGCGCGCGTCGATTTCAGCCTGCCGGTCACCGACAGCAACCCGTT
TGCCGAATCGCCCAGCAGTTTCGAGGCCTTGATGGGGCGCCAGGGCGCAGCGGTGCATACGCCGTCGCCG
CTTCATACGCCATCGCCGATCCAAGCGGCTCCGCCTGCGCATTTCCAGGGCGGGTCGGCCATGGATACCC
TGCCGGACCTGTTCGATTTCTTGACCCCAGCCAGTGTCCCGCCGGCCACCCAGCCTGACCATGTGCCGGC
CGAGCAGCACAACTTCCGCCCGCCGACGCCAATTCCCCGGCCGAGCCCACCGCCCGTGGTGGAGCCGGTG
ATACCGCCGTCTGCCTCGGTGATTCCGGATGACTGGGATCCCTTCAGCGATAAGCCGGTTCCGGTGGCGG
TAGCCCCGCAGCCCGTGGCCCCGCAGCCGGTGCCGCTACCACCTGTGGTTGAGCCGGTCGCGTCGCCTGT
CCCGCAGGCCCCGCTCGTCGACATTTTTGCTGAAATCAGCGCACCGCCGCCGGCACCCGTGCCCGAAGCG
TCGGTCACCCGCGTCGAGCCCCCGGTCGCACCTCCAGTTGCTCCAGTTGCTCAAGTTGCTTCGGTCGCTC
CAGTTGCTCCGGTCGCTCCAGTTACCCCGATCGAGGCCAACCAACCCGATTTGCTGCAAGCCTTCCTGCG
CGGTGCCGGGCTCGATCAGTTGCGCCTGGACAAGGCCAACGCCGAAGCACAGATGGAAAGCATCGGGCGC
AGTTACCGGTTGATGGTCGAAGGCCTGATCGATGTCTTGCGCGCCCGCAGCAGCCTCAAGGGTGAGTTCC
GCATCCAGCAGACGATGATCCAGCCGGTGGAAAACAACCCGCTGAAATTCGCCCCCAATGTGGATGAAGC
CTTGCTGTTGCTGTTGCGCCACGGCAACCAGGCGTTCATGGCCCCGGACGCGGCGGTGCGTGACAGTTTC
GATGACTTGCGGGCCCACCAACTGGCGGTGATGGCCGGCGTGGAAGCGGCCATCAAGCATTTGCTGGGGC
GTTTCGAGCCGGCGCAACTGGAAGAGCGCATGGCCAAGCCCGGTGGGCTCTCGGGTATTTTCAGCGGCTC
GCGACAGGCCCAGTACTGGCAGCAGTTTACCGAGCTCTACAGCAACATTTCCCGGGAAGCCCAGGAGGAT
TTCCAGGACCTGTTCGGTCGCGAGTTCAGCCGCGCCTACGAAGAACACAGTACGCGACAGCGACGCCGCT
AA