SecReT6
Protein ID: 330812629
SecReT6 ID432
T6SS typei3
Gene symbol-
Locus tagPSEBR_a5557
StrainPseudomonas brassicacearum subsp. brassicacearum NFM421
Repliconchromosome [GenBank: NC_015379] [Browse all T6SS(s) in this replicon]
Location [Strand]6701094..6702131 [+]
Producthypothetical protein
NoteTssA
UniProt IDF2K710
KEGG IDpba:PSEBR_a5557
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.10E-18, Aligned region: 53..112
Protein Sequence: 345 a.a.     [Download]
>gi|330812629|ref|YP_004357091.1| hypothetical protein PSEBR_a5557 [Pseudomonas brassicacearum subsp. brassicacearum NFM421]
MDVPLLLAAVSATSPCGEDLEYDADFLRLERDSRGQPERSMGDSILPAEPPEWRSIQQQSLDLLQRSKDL
RITHFLLQSSLALEGLPGMARVLTLISELLKQYWAELHPRLDAEDDNDPTVRINALAGLTSDITIRLLRE
SILARSRTFGAVSLRAAANASGLQSFPDENLGAEQLAGALLDSDPEQLEITRAALLEARSAAEAIEQQVS
DQVGSAQGVDLGPLKQPLKMALQILGQFAPQSGDSALSDPVSDDSAAPTEYASAPSTPRNTSTSTVSGEI
NNRDDVLRSLDRILAYYTRHEPSSPLPVLLNRAKNLVHADFAAIVRNLIPDGMSQFENLRGPDSE
 
Nucleotide Sequence: 1038 bp     [Download]
>ref|NC_015379.1|:6701094-6702131 hypothetical protein PSEBR_a5557 [Pseudomonas brassicacearum subsp. brassicacearum NFM421]
GTGGATGTGCCTTTGTTGCTCGCCGCCGTTTCCGCGACTTCGCCGTGTGGTGAAGATTTGGAATATGACG
CGGATTTCTTGCGCCTGGAACGCGACTCCCGGGGCCAGCCCGAACGCAGCATGGGCGATTCGATCCTGCC
TGCCGAACCTCCTGAGTGGCGCAGCATCCAGCAGCAGAGCCTGGACTTGCTGCAACGCAGCAAAGACCTG
CGCATCACCCATTTCCTGTTGCAAAGCTCCCTGGCCCTCGAAGGCCTGCCGGGCATGGCCCGTGTGCTGA
CGCTGATCAGCGAACTGCTCAAGCAGTACTGGGCCGAGTTGCATCCGCGCCTGGACGCCGAGGACGACAA
CGACCCCACCGTGCGCATCAATGCCCTCGCCGGCCTGACGTCCGACATCACCATTCGCTTGCTGCGCGAG
AGCATCCTGGCCCGCTCGCGGACCTTCGGTGCCGTCAGCCTGCGCGCCGCCGCCAACGCCAGCGGCCTGC
AAAGTTTCCCGGATGAAAACCTCGGCGCCGAACAGCTCGCCGGGGCCCTGCTCGACAGCGACCCCGAGCA
GTTGGAAATCACCCGTGCCGCCCTGCTGGAAGCCCGCAGCGCCGCCGAAGCCATCGAGCAGCAAGTCAGC
GACCAGGTCGGTTCCGCCCAAGGCGTGGACCTTGGCCCGCTGAAGCAACCGCTGAAGATGGCCCTGCAGA
TTCTCGGCCAGTTCGCCCCGCAGAGCGGCGACAGCGCCCTGTCCGATCCCGTCAGCGACGACAGCGCCGC
GCCAACGGAATATGCCAGCGCGCCAAGCACGCCGCGCAACACCAGCACGAGCACCGTCAGCGGCGAAATC
AACAACCGCGACGACGTGCTGCGCAGCCTGGACCGGATTCTCGCTTACTACACCCGTCATGAGCCCTCCA
GCCCGCTGCCGGTGCTGTTGAACCGGGCCAAGAATCTGGTGCACGCCGACTTCGCGGCCATTGTGCGCAA
CCTGATTCCCGACGGCATGAGTCAATTTGAAAACCTGCGCGGCCCAGACAGCGAATAA