SecReT6
Protein ID: 330812630
SecReT6 ID432
T6SS typei3
Gene symbol-
Locus tagPSEBR_a5558
StrainPseudomonas brassicacearum subsp. brassicacearum NFM421
Repliconchromosome [GenBank: NC_015379] [Browse all T6SS(s) in this replicon]
Location [Strand]6702213..6702719 [+]
Producthypothetical protein
NoteTssB
UniProt IDF2K711
KEGG IDpba:PSEBR_a5558
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.70E-60, Aligned region: 10..163
Protein Sequence: 168 a.a.     [Download]
>gi|330812630|ref|YP_004357092.1| hypothetical protein PSEBR_a5558 [Pseudomonas brassicacearum subsp. brassicacearum NFM421]
MAKQSSQKFIARNRAPRVQIEYDVELYGAEKKVQLPFVMGVMADLAGKPAEPLAAVADRKFLEIDVDNFD
SRLKAMQPRVAFHVPNELTGEGNLSLDLTFESMDDFSPAAVARKVDSLNKLLEARTQLANLLTYMDGKTG
AEEIIMKAIKDPALLQALASAPKPAQDQ
 
Nucleotide Sequence: 507 bp     [Download]
>ref|NC_015379.1|:6702213-6702719 hypothetical protein PSEBR_a5558 [Pseudomonas brassicacearum subsp. brassicacearum NFM421]
GTGGCGAAGCAAAGTTCTCAGAAATTCATCGCGCGCAACCGCGCGCCTCGAGTGCAGATCGAGTACGACG
TCGAGCTCTACGGCGCCGAGAAGAAGGTCCAGTTGCCCTTCGTCATGGGCGTGATGGCCGACCTCGCCGG
CAAGCCCGCCGAGCCTCTGGCAGCGGTGGCTGATCGCAAGTTCCTCGAGATCGACGTCGATAACTTCGAC
TCGCGCCTCAAGGCCATGCAGCCGCGCGTGGCGTTCCATGTGCCTAACGAACTGACCGGCGAAGGCAACC
TGAGCCTGGACCTGACGTTCGAAAGCATGGACGACTTCAGCCCGGCGGCCGTGGCCCGCAAGGTCGACTC
GCTGAACAAGCTGCTCGAAGCGCGCACCCAGTTGGCCAACCTGCTGACCTACATGGACGGCAAGACCGGC
GCCGAAGAAATCATCATGAAGGCGATCAAGGACCCAGCGCTGTTGCAGGCCCTGGCGAGCGCGCCGAAGC
CAGCACAGGACCAATGA