SecReT6
Protein ID: 330812631
SecReT6 ID432
T6SS typei3
Gene symbol-
Locus tagPSEBR_a5559
StrainPseudomonas brassicacearum subsp. brassicacearum NFM421
Repliconchromosome [GenBank: NC_015379] [Browse all T6SS(s) in this replicon]
Location [Strand]6702716..6704218 [+]
Producthypothetical protein
NoteTssC
UniProt IDF2K712
KEGG IDpba:PSEBR_a5559
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.10E-195, Aligned region: 69..495
BMFP [PF04380], Evalue: 0.0011, Aligned region: 23..82
Protein Sequence: 500 a.a.     [Download]
>gi|330812631|ref|YP_004357093.1| hypothetical protein PSEBR_a5559 [Pseudomonas brassicacearum subsp. brassicacearum NFM421]
MIMTDNTAREGVQNLGATEETSEFASLLLQEFKPKTERAREAVETAVRTLAEQALAQTDLVSNDAIKSIE
SIIAAIDAKLTAQVNQVIHHPDFQQLESAWRGLHYLVNNTESDEQLKIRVLNISKTDLHKTLKKFKGTAW
DQSPIFKKMYEEEYGQFGGEPYGCLVGDYYFDQSPPDVELLGELSKVCAAMHSPFIAAASPTVMGMGSWQ
ELSNPRDLTKIFTTPEYAGWRSLRESEDSRYIGLTMPRFLARLPYGAKTDPVEAFAFEENTDGADSSKYT
WANAAYAMAVNINRSFKHFGWCSRIRGVESGGEVENLPAHTFPTDDGGVDMKCPTEIAISDRREAELAKN
GFMPLLHKKNTDFAAFIGAQSLQKPAEYDDPDATANANLAARLPYLFATCRFAHYLKCIVRDKIGSFKEK
DEMQRWLQDWILNYVDGDPAHSTETTKAQHPLAAAEVIVEEVEGNPGYYNSKFYLRPHYQLEGLTVSLRL
VSKLPSAKGA
 
Nucleotide Sequence: 1503 bp     [Download]
>ref|NC_015379.1|:6702716-6704218 hypothetical protein PSEBR_a5559 [Pseudomonas brassicacearum subsp. brassicacearum NFM421]
ATGATCATGACTGACAATACAGCTCGCGAAGGCGTGCAAAACCTGGGCGCAACCGAAGAAACCAGCGAGT
TCGCGTCCCTGCTGCTGCAAGAATTCAAACCCAAGACCGAGCGCGCCCGCGAAGCCGTCGAAACGGCCGT
ACGCACCCTGGCCGAACAGGCCCTGGCGCAGACCGACCTGGTGTCCAATGACGCCATCAAGTCGATCGAA
TCGATCATCGCCGCCATCGACGCCAAGCTCACCGCCCAGGTCAACCAGGTCATCCACCACCCCGACTTCC
AGCAACTGGAAAGCGCCTGGCGTGGCCTGCACTACCTGGTCAACAACACCGAGTCCGATGAGCAGCTCAA
GATCCGCGTGCTCAACATCTCCAAGACCGACCTGCACAAGACCCTGAAGAAATTCAAGGGCACCGCGTGG
GACCAGAGCCCGATCTTCAAGAAGATGTACGAAGAAGAATACGGCCAGTTCGGCGGCGAGCCTTACGGCT
GCCTGGTAGGCGACTACTACTTCGACCAGTCGCCACCGGATGTCGAGCTGCTGGGCGAACTGTCGAAAGT
CTGCGCGGCCATGCACTCCCCGTTCATCGCTGCGGCATCGCCGACCGTGATGGGCATGGGCTCGTGGCAG
GAACTGTCGAACCCGCGCGACCTGACCAAGATCTTCACCACCCCGGAATACGCCGGCTGGCGCTCGCTGC
GTGAATCGGAAGACTCGCGCTACATCGGCCTGACCATGCCACGCTTCCTGGCGCGCCTGCCGTACGGCGC
CAAGACCGACCCGGTGGAAGCCTTCGCCTTCGAAGAAAACACCGACGGTGCCGACAGCTCCAAGTACACC
TGGGCCAACGCCGCCTACGCGATGGCGGTGAACATCAACCGTTCGTTCAAACACTTCGGCTGGTGCTCGC
GCATCCGTGGCGTGGAGTCCGGCGGTGAAGTGGAAAACCTGCCAGCCCACACCTTCCCGACCGACGACGG
TGGCGTGGACATGAAGTGCCCAACCGAAATCGCCATTTCGGACCGCCGTGAAGCGGAGCTGGCGAAGAAC
GGTTTCATGCCGCTGCTGCACAAGAAAAACACCGACTTCGCCGCGTTCATCGGCGCCCAGTCCCTGCAGA
AACCGGCCGAATACGACGACCCGGACGCCACCGCCAACGCCAACCTGGCCGCGCGCCTGCCGTACCTGTT
CGCCACTTGCCGTTTCGCCCATTACCTCAAGTGCATCGTGCGCGACAAGATCGGTTCCTTCAAAGAGAAG
GACGAGATGCAGCGCTGGTTGCAGGACTGGATCCTCAACTACGTCGACGGTGACCCGGCGCACTCCACCG
AGACCACCAAGGCCCAGCACCCGTTGGCTGCAGCCGAAGTGATCGTCGAAGAAGTCGAAGGCAACCCGGG
GTACTACAACTCCAAGTTCTACCTGCGCCCGCACTACCAGCTCGAAGGGCTGACCGTGTCGTTGCGCCTG
GTATCGAAACTGCCTTCGGCCAAGGGCGCATAA