SecReT6
Protein ID: 330812632
SecReT6 ID432
T6SS typei3
Gene symbol-
Locus tagPSEBR_a5560
StrainPseudomonas brassicacearum subsp. brassicacearum NFM421
Repliconchromosome [GenBank: NC_015379] [Browse all T6SS(s) in this replicon]
Location [Strand]6704439..6704927 [+]
Producthemolysin co-regulated type VI secretion system effector
NoteTssD
UniProt IDF2K713
KEGG IDpba:PSEBR_a5560
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.30E-46, Aligned region: 6..137
Protein Sequence: 162 a.a.     [Download]
>gi|330812632|ref|YP_004357094.1| hemolysin co-regulated type VI secretion system effector [Pseudomonas brassicacearum subsp. brassicacearum NFM421]
MAVDIFIKIGDIKGESMDKAHKDEIDVLNWSWGMSQSGNMHVGSGGGAGKVNVQDLSLTKYVDKASPNLM
MHCASGKHIDKVKLTVRKAGGESQVEYMIINLEEVLVTSLSTGGSGGDDRLTENVTLNFAKVLVDYQPQK
ADGTKEGGPVKFGWNIRQNVKV
 
Nucleotide Sequence: 489 bp     [Download]
>ref|NC_015379.1|:6704439-6704927 hemolysin co-regulated type VI secretion system effector [Pseudomonas brassicacearum subsp. brassicacearum NFM421]
ATGGCTGTTGATATTTTCATCAAGATTGGCGACATCAAGGGCGAGTCCATGGACAAGGCCCACAAGGACG
AGATCGATGTCCTGAACTGGAGCTGGGGCATGTCCCAGTCCGGCAACATGCACGTGGGCAGCGGCGGTGG
TGCGGGCAAGGTCAACGTCCAGGACCTGTCCCTGACCAAGTACGTCGACAAGGCGTCGCCGAACCTGATG
ATGCACTGCGCCAGCGGCAAGCACATCGACAAGGTCAAGCTGACCGTGCGCAAGGCCGGCGGTGAAAGCC
AGGTCGAGTACATGATCATCAACCTGGAAGAAGTGCTGGTCACTTCCCTGAGCACCGGCGGCTCGGGCGG
CGATGATCGCCTGACTGAAAACGTCACCCTGAACTTCGCCAAGGTGCTGGTGGACTACCAGCCACAGAAA
GCCGACGGCACCAAGGAAGGCGGTCCGGTCAAGTTCGGCTGGAACATCCGTCAGAACGTCAAGGTGTAA