SecReT6
Protein ID: 330812635
SecReT6 ID432
T6SS typei3
Gene symbol-
Locus tagPSEBR_a5563
StrainPseudomonas brassicacearum subsp. brassicacearum NFM421
Repliconchromosome [GenBank: NC_015379] [Browse all T6SS(s) in this replicon]
Location [Strand]6705904..6706416 [+]
Producthypothetical protein
NoteTssE
UniProt IDF2K716
KEGG IDpba:PSEBR_a5563
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.60E-23, Aligned region: 37..145
Protein Sequence: 170 a.a.     [Download]
>gi|330812635|ref|YP_004357097.1| hypothetical protein PSEBR_a5563 [Pseudomonas brassicacearum subsp. brassicacearum NFM421]
MVTEIATRDRLQPSLLDRLTDDDPTNPKESADKRVLSLTQLKASVLRDLAWLLNTTSLLSADATLHTPAG
TSVVNFGLPALAGNSASNVDVSALETLIHQAIATFEPRILRHTLRVRARATAEMNHNALSFEIEGDLWAQ
PVPLRLMLQTDLDLETGHVRVVNADQRRRS
 
Nucleotide Sequence: 513 bp     [Download]
>ref|NC_015379.1|:6705904-6706416 hypothetical protein PSEBR_a5563 [Pseudomonas brassicacearum subsp. brassicacearum NFM421]
TTGGTAACCGAAATCGCCACCCGCGATCGCCTTCAACCGTCCCTGCTGGACCGGTTGACCGACGACGATC
CGACCAACCCGAAGGAAAGCGCCGACAAGCGCGTGCTCTCCCTGACCCAATTAAAAGCCTCGGTGCTGCG
TGACCTGGCGTGGCTGCTCAACACCACCTCATTGCTCAGCGCCGATGCCACGCTGCATACCCCGGCGGGC
ACGTCGGTGGTGAATTTCGGGCTGCCGGCACTGGCCGGCAACAGCGCGTCGAACGTCGATGTCTCGGCCC
TGGAAACCTTGATCCACCAGGCCATTGCCACCTTCGAACCGCGAATCCTGCGCCACACCCTGCGAGTGCG
CGCCCGAGCGACGGCCGAGATGAACCACAATGCGTTGAGTTTCGAGATCGAAGGCGATCTCTGGGCGCAG
CCGGTGCCGCTGCGCCTGATGCTGCAAACCGACCTGGACCTGGAAACCGGCCATGTGCGCGTGGTCAACG
CCGACCAGCGGAGACGCTCATGA