SecReT6
Protein ID: 330812636
SecReT6 ID432
T6SS typei3
Gene symbol-
Locus tagPSEBR_a5564
StrainPseudomonas brassicacearum subsp. brassicacearum NFM421
Repliconchromosome [GenBank: NC_015379] [Browse all T6SS(s) in this replicon]
Location [Strand]6706413..6708272 [+]
Producthypothetical protein
NoteTssF
UniProt IDF2K717
KEGG IDpba:PSEBR_a5564
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.50E-219, Aligned region: 5..618
Protein Sequence: 619 a.a.     [Download]
>gi|330812636|ref|YP_004357098.1| hypothetical protein PSEBR_a5564 [Pseudomonas brassicacearum subsp. brassicacearum NFM421]
MNPRLLELYNQELHHVRESAAEFAKEYPKIASRLTLSGMDCADPYVERLLEGFAYLTARVQLKLDAEYPT
FTHNLLEIAYPHYLAPTPSMTVVQLQADPDEGSLSSGFPLPRDTVLRAALGRETQTCCEYRTAHAVTLWP
LQVSQAEYFGNPSAVLGRLAASEPKAKAGLRLTLRTGAELPFNSLALDNLPLYLSGADEQPFRLYEQLLG
NACAVFARKPGGDWVERLPQDALRSRGFDDADAALPVVPRAFQGYRLLQEYFALPHRFLFVDFTQLSRAV
KRCDGQELELIVLFDRHDPSLEGSVGASQFLPFCTPAINLFPKRLDRIHLSDRVNEHHVIADRTRPMDFE
VHSLNGLTGHGTGPEQPFLPFYAVRDPSRYGRDQAYYTVRREPRVLSSDQRRNGPRSTYIGSETFVSLVD
SQQAPYRHDLRQLGVTALCTNRDLPLFMSVGNGKTDFTLADSAPVGAVRCVAGPSRPRASHAHDAKAWRL
ISQLSLNYLSLSEQGQGAAALRELLRLYGDSNDAALQLQIEGLREVSSKACTRRLPMPGPIVFGRGLEIT
LEFDENAFRGTGVFLLGAVFERFLARYVSINSFTETVIRTTERGEIMRWKAKPGRRPTL
 
Nucleotide Sequence: 1860 bp     [Download]
>ref|NC_015379.1|:6706413-6708272 hypothetical protein PSEBR_a5564 [Pseudomonas brassicacearum subsp. brassicacearum NFM421]
ATGAATCCACGCCTGCTGGAACTGTACAACCAGGAACTGCACCACGTGCGCGAAAGCGCGGCGGAGTTCG
CCAAGGAATACCCGAAGATCGCCAGTCGGCTGACGTTGTCCGGCATGGACTGCGCCGACCCGTATGTCGA
GCGCCTGCTGGAAGGCTTCGCCTACCTGACGGCACGAGTGCAGCTCAAGCTCGACGCCGAGTACCCGACC
TTCACCCACAACCTGCTGGAAATCGCCTACCCGCATTACCTGGCGCCGACGCCGTCGATGACGGTGGTGC
AATTGCAGGCCGACCCGGACGAAGGCTCGCTGAGCAGTGGTTTCCCGCTGCCGCGCGATACGGTCCTGCG
TGCCGCCCTGGGGCGTGAAACCCAGACCTGCTGCGAGTACCGCACCGCCCACGCGGTGACGTTGTGGCCG
TTGCAGGTCAGCCAGGCCGAGTACTTCGGCAACCCGTCCGCCGTGCTCGGGCGCCTGGCCGCCAGCGAAC
CGAAAGCCAAGGCCGGCCTGCGCCTGACCCTGCGCACCGGCGCCGAACTGCCGTTCAACAGCCTGGCCCT
GGACAACCTGCCGCTGTACTTGAGCGGTGCCGACGAACAGCCCTTCCGCCTCTACGAACAACTGCTGGGC
AATGCCTGCGCGGTGTTCGCCCGCAAGCCCGGCGGCGACTGGGTGGAGCGGCTGCCGCAGGATGCGTTGC
GCTCGCGCGGCTTCGACGATGCCGACGCCGCGCTGCCGGTGGTGCCGCGGGCCTTCCAGGGCTATCGCCT
GTTGCAGGAATATTTCGCCCTGCCCCACCGTTTCCTGTTCGTCGACTTCACCCAGCTGAGCCGCGCGGTC
AAGCGTTGCGACGGCCAGGAGCTGGAGCTGATCGTGCTGTTCGACCGTCACGATCCGAGCCTGGAAGGCA
GCGTCGGCGCTTCGCAGTTCCTGCCGTTCTGCACCCCGGCCATCAACCTGTTTCCCAAGCGCCTGGACCG
CATTCACTTGTCGGATCGGGTCAACGAACACCACGTGATCGCCGACCGTACCCGGCCGATGGATTTCGAA
GTGCATTCGCTGAACGGCCTCACCGGCCACGGCACCGGGCCGGAGCAACCGTTCCTGCCGTTCTACGCCG
TACGCGATCCGTCCCGTTATGGCCGCGACCAGGCCTATTACACCGTGCGGCGCGAACCGCGCGTGCTGTC
CAGCGACCAGCGACGCAACGGCCCGCGCTCGACCTACATCGGCAGCGAGACCTTCGTCAGCCTGGTGGAC
AGCCAGCAAGCGCCCTATCGCCACGACCTGCGCCAACTGGGCGTGACCGCTCTGTGCACCAACCGCGACC
TGCCGCTGTTCATGAGCGTGGGCAACGGCAAGACCGACTTCACCCTCGCCGACAGTGCGCCGGTTGGCGC
CGTGCGCTGCGTGGCCGGGCCCAGTCGCCCACGGGCCAGCCATGCCCACGACGCCAAGGCCTGGCGGCTG
ATCAGCCAGTTGTCGCTGAACTACTTGTCGTTGAGCGAACAAGGCCAAGGCGCAGCCGCCCTGCGTGAAC
TGCTGCGCCTGTACGGCGACAGCAACGACGCGGCGCTGCAGTTGCAGATCGAAGGCCTGCGCGAAGTCAG
CAGCAAAGCCTGCACCCGGCGCTTGCCGATGCCTGGCCCGATCGTGTTTGGTCGCGGCCTGGAGATCACC
CTGGAATTCGATGAAAACGCGTTTCGCGGCACCGGGGTGTTCCTGCTCGGCGCGGTGTTCGAGCGCTTCC
TGGCACGCTACGTGTCGATCAACAGTTTTACCGAGACGGTGATCCGTACCACCGAACGCGGCGAGATCAT
GCGATGGAAAGCCAAGCCCGGACGTCGTCCGACCCTGTGA