SecReT6
Protein ID: 330812637
SecReT6 ID432
T6SS typei3
Gene symbol-
Locus tagPSEBR_a5565
StrainPseudomonas brassicacearum subsp. brassicacearum NFM421
Repliconchromosome [GenBank: NC_015379] [Browse all T6SS(s) in this replicon]
Location [Strand]6708287..6709288 [+]
Producthypothetical protein
NoteTssG
UniProt IDF2K718
KEGG IDpba:PSEBR_a5565
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.40E-109, Aligned region: 3..303
Protein Sequence: 333 a.a.     [Download]
>gi|330812637|ref|YP_004357099.1| hypothetical protein PSEBR_a5565 [Pseudomonas brassicacearum subsp. brassicacearum NFM421]
MHQEPWEYDFFQALRRIECESPELPRLGHSLRLADDPLRLGQRAECTFAPATLASVQPGSDGAPARLEQF
FFGLGGPNGPMPLHITEYVRERQRNNADSTSKRFLDVFHHRLLSLFYRAWAEARPTVSHDRPDDDYWSAR
LAALSGRGMPSLLNQGLIPDTAKLHYSGHLAAQTRYPDGLKAILGEYFGLPVEIEEYVGQWLELPERSRV
GVSAHQLGVDFCLGRFVWDRQHKFRIRLGPLKLVDYMGMLPGSQPFNELVAWVAEYLGHELDWDLNLVLE
QPEVPALQLNGRFRLGFNTWLGRPETDANDLILARHYAEQANTSQTSRSHEHG
 
Nucleotide Sequence: 1002 bp     [Download]
>ref|NC_015379.1|:6708287-6709288 hypothetical protein PSEBR_a5565 [Pseudomonas brassicacearum subsp. brassicacearum NFM421]
ATGCACCAGGAACCCTGGGAATACGATTTCTTCCAGGCGTTGCGGCGCATCGAGTGCGAATCCCCCGAGC
TGCCGCGCCTGGGCCATTCCCTGCGCCTGGCCGACGACCCGCTGCGCCTCGGGCAACGGGCCGAATGCAC
CTTCGCCCCGGCCACCCTTGCCTCGGTGCAACCGGGCAGCGACGGTGCGCCGGCACGCCTGGAGCAATTT
TTCTTCGGCCTCGGCGGACCCAACGGCCCGATGCCGCTGCACATCACCGAATACGTGCGCGAACGCCAGC
GCAACAACGCCGACAGCACCAGCAAGCGCTTCCTCGATGTGTTTCACCATCGCCTGCTCAGCCTGTTTTA
TCGGGCCTGGGCCGAAGCGCGGCCGACGGTCAGCCACGATCGCCCGGACGATGACTATTGGTCGGCGCGC
CTGGCGGCACTGAGCGGTCGGGGCATGCCCAGCCTGCTCAACCAGGGGTTGATTCCCGACACGGCGAAGC
TGCACTACAGCGGCCACCTGGCAGCGCAAACCCGCTACCCGGACGGTTTGAAGGCAATCCTCGGCGAGTA
CTTCGGCCTTCCGGTGGAGATCGAAGAATACGTCGGCCAATGGCTGGAACTGCCCGAACGCAGCCGCGTC
GGGGTCAGCGCTCATCAATTGGGCGTGGACTTCTGCCTGGGCCGCTTCGTGTGGGATCGCCAGCACAAAT
TCCGCATTCGCCTGGGGCCACTCAAGCTCGTTGACTACATGGGCATGCTGCCTGGCAGCCAACCGTTCAA
CGAGCTGGTGGCCTGGGTCGCCGAATACCTGGGCCATGAACTGGACTGGGACCTGAACCTGGTCCTGGAA
CAGCCCGAAGTCCCGGCATTGCAACTCAATGGGCGTTTCCGCCTGGGTTTCAATACCTGGCTGGGCCGCC
CCGAAACAGATGCCAACGATTTAATACTGGCCCGGCATTACGCCGAACAGGCCAACACCTCACAGACCTC
AAGGAGCCATGAGCATGGGTGA