SecReT6
Protein ID: 330812638
SecReT6 ID432
T6SS typei3
Gene symbol-
Locus tagPSEBR_a5566
StrainPseudomonas brassicacearum subsp. brassicacearum NFM421
Repliconchromosome [GenBank: NC_015379] [Browse all T6SS(s) in this replicon]
Location [Strand]6709281..6711971 [+]
Productchaperone
NoteTssH
UniProt IDF2K719
KEGG IDpba:PSEBR_a5566
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 5.10E-39, Aligned region: 625..791
AAA [PF00004], Evalue: 1.60E-18, Aligned region: 234..368
AAA [PF00004], Evalue: 1.60E-18, Aligned region: 631..715
ClpB_D2-small [PF10431], Evalue: 9.50E-16, Aligned region: 798..872
AAA_5 [PF07728], Evalue: 1.10E-12, Aligned region: 234..253
AAA_5 [PF07728], Evalue: 1.10E-12, Aligned region: 351..364
AAA_5 [PF07728], Evalue: 1.10E-12, Aligned region: 630..756
AAA_16 [PF13191], Evalue: 4.40E-12, Aligned region: 43..78
AAA_16 [PF13191], Evalue: 4.40E-12, Aligned region: 211..251
AAA_16 [PF13191], Evalue: 4.40E-12, Aligned region: 278..313
AAA_16 [PF13191], Evalue: 4.40E-12, Aligned region: 482..545
AAA_16 [PF13191], Evalue: 4.40E-12, Aligned region: 600..675
AAA_16 [PF13191], Evalue: 4.40E-12, Aligned region: 789..845
Sigma54_activat [PF00158], Evalue: 8.10E-07, Aligned region: 213..247
Sigma54_activat [PF00158], Evalue: 8.10E-07, Aligned region: 629..749
AAA_22 [PF13401], Evalue: 2.40E-06, Aligned region: 63..98
AAA_22 [PF13401], Evalue: 2.40E-06, Aligned region: 233..314
AAA_22 [PF13401], Evalue: 2.40E-06, Aligned region: 358..400
AAA_22 [PF13401], Evalue: 2.40E-06, Aligned region: 628..651
AAA_22 [PF13401], Evalue: 2.40E-06, Aligned region: 692..712
AAA_25 [PF13481], Evalue: 2.30E-05, Aligned region: 229..311
AAA_25 [PF13481], Evalue: 2.30E-05, Aligned region: 499..556
AAA_25 [PF13481], Evalue: 2.30E-05, Aligned region: 628..655
Zeta_toxin [PF06414], Evalue: 3.80E-05, Aligned region: 234..250
Zeta_toxin [PF06414], Evalue: 3.80E-05, Aligned region: 624..670
Arch_ATPase [PF01637], Evalue: 0.00012, Aligned region: 212..250
Arch_ATPase [PF01637], Evalue: 0.00012, Aligned region: 285..318
Arch_ATPase [PF01637], Evalue: 0.00012, Aligned region: 630..651
Arch_ATPase [PF01637], Evalue: 0.00012, Aligned region: 701..712
AAA_19 [PF13245], Evalue: 0.00029, Aligned region: 17..46
AAA_19 [PF13245], Evalue: 0.00029, Aligned region: 234..255
AAA_19 [PF13245], Evalue: 0.00029, Aligned region: 628..652
NACHT [PF05729], Evalue: 0.0003, Aligned region: 234..334
NACHT [PF05729], Evalue: 0.0003, Aligned region: 631..657
AAA_18 [PF13238], Evalue: 0.00041, Aligned region: 234..251
AAA_18 [PF13238], Evalue: 0.00041, Aligned region: 632..659
AAA_18 [PF13238], Evalue: 0.00041, Aligned region: 819..861
IstB_IS21 [PF01695], Evalue: 0.00042, Aligned region: 217..255
IstB_IS21 [PF01695], Evalue: 0.00042, Aligned region: 630..658
AAA_17 [PF13207], Evalue: 0.00095, Aligned region: 234..251
AAA_17 [PF13207], Evalue: 0.00095, Aligned region: 630..666
AAA_17 [PF13207], Evalue: 0.00095, Aligned region: 817..839
AAA_29 [PF13555], Evalue: 0.0018, Aligned region: 226..250
AAA_29 [PF13555], Evalue: 0.0018, Aligned region: 628..655
Torsin [PF06309], Evalue: 0.0021, Aligned region: 588..654
Clp_N [PF02861], Evalue: 0.0037, Aligned region: 29..75
Clp_N [PF02861], Evalue: 0.0037, Aligned region: 108..142
Protein Sequence: 896 a.a.     [Download]
>gi|330812638|ref|YP_004357100.1| chaperone [Pseudomonas brassicacearum subsp. brassicacearum NFM421]
MGEISRAALFGKLNSVAYKAIEAATVFCKLRGNPYVELAHWFHQLLQLQDSDLHRIIRQFNIEPARLARD
LTEALDRLPRGSTSITDLSSHVEEAVERGWVYGSLMFGESQVRTGYLVLGILKTPSLRHALLGLSSEFDK
VKVEALSERFDEYVGDSPENALTASDGFNAGAVPGEASGAMAPSAMGKQEALKRFTVDLTEQARSGKLDP
IVGRDEEIRQLVDILMRRRQNNPILTGEAGVGKTAVVEGFALRIVAGDVPPALKDVELRSLDVGLLQAGA
SMKGEFEQRLRQVIEDVQASPKPIILFIDEAHTLVGAGGAAGTGDAANLLKPALARGTLRTVAATTWAEY
KKHIEKDPALTRRFQVVQVAEPSEDKALLMMRGVASTMEKHHQVQILDEALEASVKLSHRYIPARQLPDK
SVSLLDTACARVAISLHAVPAEVDDSRRRIEALETELQIIAREHAIGVVIGNRQTQSETLLSAERERLAE
LEGRWAEEKTLVDELLATRATLRERVGVVDSEDNSEASDNESHQLREKLVDLQQRLTALQGETPLILPTV
DYQAVASVVADWTGIPVGRMARNELETVLNLDQHLKKRIIGQDHALQMIAKRIQTSRAGLDNPSKPIGVF
MLAGTSGVGKTETALALAEAMYGGEQNVITINMSEFQEAHTVSTLKGAPPGYIGYGEGGVLTEAVRRKPY
SVVLLDEVEKAHPDVHEIFFQVFDKGVMEDGEGRVIDFKNTLILLTTNAGTELIAQVCKDPQNVPEPEEI
AKALRQPLLEIFPPALLGRLVTIPYYPLSDEMLKAITRLQLNRIKKRVESTHKVAFDYDDAVIDLIVSRC
TETESGGRMIDTILTNSLLPDMSREFLTRMLEGKALAGVRISAVDNELQYDFSDAA
 
Nucleotide Sequence: 2691 bp     [Download]
>ref|NC_015379.1|:6709281-6711971 chaperone [Pseudomonas brassicacearum subsp. brassicacearum NFM421]
ATGGGTGAAATCAGTCGCGCCGCGTTGTTCGGCAAACTCAACAGCGTGGCCTACAAAGCCATCGAAGCCG
CCACCGTGTTCTGCAAGTTGCGCGGTAACCCTTATGTGGAACTGGCCCACTGGTTTCACCAGTTGCTGCA
ACTGCAGGACTCGGACCTGCACCGCATCATCCGCCAGTTCAACATCGAACCGGCGCGCCTGGCCCGTGAC
CTGACCGAAGCCCTGGATCGCCTGCCACGGGGTTCGACGTCCATCACCGACCTGTCGTCCCACGTCGAAG
AAGCCGTGGAGCGCGGCTGGGTCTACGGCAGCCTGATGTTCGGCGAAAGCCAGGTTCGCACCGGTTACCT
GGTGCTGGGCATTCTCAAGACCCCGAGCCTGCGCCACGCACTGCTGGGCTTGTCGTCGGAGTTCGATAAG
GTCAAGGTCGAAGCCCTGAGCGAACGGTTTGACGAATACGTCGGCGACTCGCCGGAAAACGCCCTGACCG
CCAGCGACGGCTTCAATGCCGGCGCGGTGCCGGGCGAAGCCAGCGGCGCCATGGCCCCTAGCGCCATGGG
CAAGCAGGAAGCCCTCAAGCGCTTTACCGTCGACCTCACCGAGCAGGCCCGCAGCGGCAAGCTCGACCCG
ATCGTCGGCCGTGACGAAGAGATCCGCCAACTGGTGGACATCCTCATGCGCCGCCGGCAGAACAACCCGA
TCCTTACCGGTGAAGCCGGCGTGGGCAAGACCGCCGTGGTCGAAGGCTTCGCCCTGCGCATCGTCGCCGG
CGACGTGCCGCCGGCCCTCAAGGACGTGGAACTGCGCAGCCTCGACGTGGGCCTGTTGCAGGCCGGCGCC
AGCATGAAAGGCGAGTTCGAACAGCGCCTGCGCCAGGTCATCGAAGACGTCCAGGCCTCGCCCAAGCCGA
TCATCCTGTTCATCGACGAAGCCCACACCCTGGTCGGTGCCGGTGGCGCCGCCGGCACGGGCGACGCGGC
CAACCTGCTCAAGCCGGCGTTGGCCCGTGGCACCTTGCGCACCGTGGCCGCCACGACCTGGGCCGAGTAC
AAGAAGCACATCGAAAAAGACCCGGCCCTGACCCGCCGCTTCCAAGTGGTGCAAGTGGCCGAGCCGTCGG
AAGACAAGGCCCTGCTGATGATGCGCGGCGTGGCCTCGACCATGGAAAAACACCACCAGGTGCAGATCCT
CGACGAAGCCCTGGAAGCTTCGGTCAAGCTGTCCCACCGCTACATTCCCGCGCGCCAGCTGCCGGACAAA
TCCGTGAGCCTGCTGGACACCGCCTGCGCCCGCGTCGCCATCAGCCTGCACGCCGTACCGGCCGAAGTGG
ACGACAGCCGTCGGCGCATCGAAGCGCTGGAAACCGAGTTGCAAATCATCGCCCGTGAACACGCGATTGG
CGTGGTCATCGGCAACCGCCAGACCCAGAGCGAAACCCTGCTGAGCGCCGAGCGCGAACGCCTGGCCGAG
CTGGAAGGCCGCTGGGCCGAAGAGAAAACCCTGGTGGACGAACTGCTCGCCACCCGCGCCACCTTGCGCG
AACGCGTTGGCGTGGTGGACAGCGAAGACAACAGCGAAGCTTCTGACAACGAAAGCCACCAACTGCGCGA
GAAGCTGGTGGACCTGCAACAGCGCCTGACCGCCCTGCAAGGCGAAACCCCGCTGATCCTGCCGACCGTG
GATTACCAGGCCGTGGCCTCGGTGGTCGCCGACTGGACCGGTATCCCGGTGGGCCGCATGGCCCGCAACG
AACTGGAAACCGTGCTCAACCTCGACCAGCACCTGAAGAAACGCATCATCGGCCAGGACCATGCCTTGCA
GATGATTGCCAAGCGCATCCAGACCTCCCGCGCCGGCCTCGACAACCCGAGCAAGCCGATTGGTGTGTTC
ATGCTCGCCGGCACCTCCGGCGTGGGCAAGACCGAAACCGCCCTGGCCCTGGCCGAAGCCATGTACGGCG
GCGAGCAGAACGTCATCACCATCAACATGAGCGAGTTCCAGGAAGCCCACACCGTATCGACCCTCAAGGG
TGCGCCACCGGGCTACATCGGCTATGGCGAAGGCGGCGTGCTGACCGAAGCCGTGCGGCGCAAACCGTAC
AGTGTGGTGTTGCTGGACGAGGTCGAGAAGGCCCACCCGGACGTGCATGAGATCTTCTTCCAGGTGTTCG
ACAAAGGCGTGATGGAGGACGGTGAAGGCCGGGTGATCGACTTCAAGAACACCTTGATCCTGCTGACCAC
CAACGCCGGCACCGAGTTGATTGCCCAGGTCTGCAAAGACCCGCAGAACGTGCCCGAGCCGGAAGAAATC
GCCAAGGCCCTGCGCCAACCGCTGCTGGAGATTTTCCCGCCAGCCTTGCTGGGCCGCCTGGTGACGATCC
CGTACTACCCGCTCAGCGACGAGATGCTCAAGGCCATCACCCGCCTGCAACTCAACCGCATCAAGAAGCG
CGTGGAAAGCACCCACAAAGTCGCCTTCGACTACGACGACGCGGTGATCGACCTGATCGTCTCGCGTTGC
ACCGAAACCGAAAGCGGCGGGCGCATGATCGACACCATCCTGACCAACAGCCTGCTGCCGGACATGAGCC
GCGAGTTCCTGACCCGCATGCTCGAAGGCAAGGCTTTGGCCGGGGTGCGGATCAGCGCCGTGGACAATGA
ATTGCAGTACGATTTCAGCGACGCGGCCTGA