SecReT6
Protein ID: 330814651
SecReT6 ID434
T6SS typei3
Gene symbol-
Locus tagbgla_4p2320
StrainBurkholderia gladioli BSR3
Repliconplasmid bgla_4p [GenBank: NC_015383] [Browse all T6SS(s) in this replicon]
Location [Strand]244508..247243 [-]
Producttype VI secretion system Vgr family protein
NoteTssI
UniProt IDF2LSX4
KEGG IDbgd:bgla_4p2320
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.00E-75, Aligned region: 63..383
Phage_GPD [PF05954], Evalue: 1.00E-75, Aligned region: 635..661
DUF2345 [PF10106], Evalue: 2.10E-45, Aligned region: 504..559
DUF2345 [PF10106], Evalue: 2.10E-45, Aligned region: 668..818
T6SS_Vgr [PF13296], Evalue: 2.20E-30, Aligned region: 433..449
T6SS_Vgr [PF13296], Evalue: 2.20E-30, Aligned region: 528..636
T6SS_Vgr [PF13296], Evalue: 2.20E-30, Aligned region: 757..810
Phage_base_V [PF04717], Evalue: 2.50E-14, Aligned region: 189..211
Phage_base_V [PF04717], Evalue: 2.50E-14, Aligned region: 267..313
Phage_base_V [PF04717], Evalue: 2.50E-14, Aligned region: 422..507
Sarcoglycan_1 [PF04790], Evalue: 7.00E-05, Aligned region: 508..546
Sarcoglycan_1 [PF04790], Evalue: 7.00E-05, Aligned region: 680..715
Sarcoglycan_1 [PF04790], Evalue: 7.00E-05, Aligned region: 741..792
Protein Sequence: 911 a.a.     [Download]
>gi|330814651|ref|YP_004362826.1| type VI secretion system Vgr family protein [Burkholderia gladioli BSR3]
MVTFAETRTLSISGAALPTYSTGGLPVFAPVRLQGSEAVGRLEDCRYLVTLRTDDAFAFSPSVTANLDLD
KIVGTEVTVSIQLEGKGQFIPGLAGNAGLGNIGAGTREITGLVTAARVAGEDRHSILYELELRPWLYRAT
LTQDCRIFQDMSVVEITDAVLAKYPYPVDKRLAGAFRGIYPKRDVQRQAFETDWAFLQRLWEEWGIWWWF
EHEGGHQRLVLCDTMGGHHPHGAAYETVRYLSPDGKRIDEEHIHALSVTSRLTSGSVTVVDYDYTRPRAN
LTVTEENPRKTASADGAVYDWGDYSQPLAGAQGVEGQPNDTEQESRHLARVQLEARRCAGLRANGKGNLR
GLTVGRTFALTGYPQQAANREYVVLSSTLDIEEVGDRTGASATYRCEAQFELLPANEPFRLERSVRKPVL
SGPEKAIVVGPAGQEVWTDKYGRVKAQFGWDRQGKLDEHSGIWLRVVSPWQGADMGATFLPRIGHEVAVM
HYYGDPDLPVITGSPVNEFRQPTLELPANQAVAVLRGREFQGTASGHVAIDDTQGQIQTQIASDAGSSVL
ALGNIRRIVKKTGRADARGKGFDLRTDYWGVVRALMGLFISTDGQANGAGQTKEAKAAVGRLTRARELQE
SLSGLAQQHEAQQRDADQSEVAKAIKARNDAIRGDAPAGENDFPELKEPDLVLASAAGVSVAAERGAHVA
SNEDIAMTSGRHVGLAVGHSLFASVSNAFSLFVHKAGMKLIAAAGKVRIEAQTDGIDMKAKQSVKIESTT
DSIELHAAKEIVLHAGSTQMRISDQGYTVHTAGEHTIHAGSHQTDGPQGQGGGFPPFPKSGPGQLEVLRH
YVTDAPVDKNTIAVTDSLGAVHKGTLDASGRTIVSGLAPGAVTVQYGHDPHDSWVMSSYLKQPRWNPAGA
A
 
Nucleotide Sequence: 2736 bp     [Download]
>gi|330814453|ref|NC_015383.1|:c247243-244508 Burkholderia gladioli BSR3 plasmid bgla_4p, complete sequence
ATGGTGACATTCGCCGAAACTCGCACGCTGTCGATTTCCGGCGCGGCGCTACCCACGTATTCGACCGGCG
GGCTGCCGGTGTTCGCACCGGTGCGGCTGCAGGGCAGCGAGGCGGTCGGCCGTCTCGAGGATTGCCGCTA
CCTCGTCACGTTGCGCACCGACGACGCGTTCGCGTTCTCGCCGAGTGTGACCGCCAACCTCGACCTCGAC
AAGATCGTCGGCACCGAGGTCACGGTGTCAATTCAGCTCGAAGGCAAGGGGCAGTTCATCCCCGGGCTCG
CCGGCAACGCCGGGCTGGGCAACATCGGCGCGGGCACGCGCGAGATCACGGGCCTCGTCACCGCGGCGCG
CGTCGCCGGCGAAGACCGGCACTCGATCCTATACGAGCTCGAGCTGCGCCCGTGGCTGTACCGCGCGACG
CTGACGCAGGACTGCCGGATCTTCCAGGACATGAGCGTCGTCGAGATCACCGACGCGGTGCTGGCGAAGT
ATCCGTACCCGGTCGACAAACGGCTGGCTGGCGCGTTCCGCGGCATCTATCCGAAGCGCGACGTGCAGCG
CCAGGCGTTCGAGACCGATTGGGCGTTCCTGCAGCGCTTGTGGGAGGAATGGGGTATCTGGTGGTGGTTC
GAGCACGAGGGCGGACATCAGCGCCTGGTGCTGTGCGACACGATGGGCGGCCACCACCCGCACGGCGCGG
CGTACGAGACGGTGCGCTACCTGTCGCCGGACGGCAAGCGGATCGACGAGGAGCATATTCACGCGCTGTC
GGTAACGAGCCGGCTGACGTCGGGCAGCGTGACCGTGGTGGACTACGACTACACGCGGCCACGCGCGAAC
CTGACGGTCACCGAGGAGAACCCGCGCAAGACGGCGAGCGCGGACGGCGCGGTGTACGACTGGGGCGACT
ACAGCCAGCCGCTGGCGGGTGCGCAAGGCGTGGAAGGCCAGCCGAACGATACCGAGCAGGAATCGCGGCA
CCTGGCGCGCGTGCAGTTGGAGGCACGACGCTGCGCGGGCCTGCGTGCTAATGGGAAGGGCAACCTGCGC
GGGCTGACTGTGGGTCGCACCTTCGCGCTGACGGGTTACCCGCAGCAGGCGGCGAACCGCGAGTACGTGG
TGCTGTCGTCGACGCTCGACATCGAGGAGGTGGGCGATCGCACGGGCGCGAGCGCGACGTATCGCTGCGA
AGCGCAGTTCGAGCTGCTGCCGGCGAACGAGCCGTTCCGGCTCGAGCGTAGCGTGCGCAAGCCGGTGCTG
AGCGGCCCCGAGAAGGCGATAGTGGTGGGGCCGGCCGGCCAGGAAGTGTGGACCGACAAATACGGCCGTG
TGAAGGCCCAGTTCGGCTGGGACCGTCAGGGCAAGCTCGACGAGCATTCGGGGATCTGGCTGCGAGTGGT
GTCCCCGTGGCAAGGCGCCGACATGGGCGCGACGTTCCTGCCGCGGATCGGCCACGAAGTTGCTGTGATG
CACTACTACGGCGACCCGGACCTGCCGGTGATCACGGGCAGCCCGGTGAACGAGTTCCGGCAGCCGACGC
TGGAGCTGCCGGCGAACCAGGCGGTGGCGGTGCTGCGCGGCCGCGAGTTTCAGGGCACGGCGTCGGGCCA
CGTGGCGATCGACGATACGCAAGGGCAGATCCAGACGCAGATTGCGAGCGACGCGGGTAGCTCGGTGCTG
GCGTTGGGGAACATCCGGCGCATCGTGAAGAAGACCGGCCGGGCCGACGCACGCGGCAAGGGCTTCGACC
TGCGCACCGATTACTGGGGCGTGGTGCGGGCACTGATGGGCCTGTTCATCTCGACGGACGGGCAGGCGAA
CGGCGCCGGCCAGACGAAGGAGGCGAAGGCGGCGGTCGGGCGGCTGACGCGGGCGCGCGAATTGCAGGAG
AGCCTGTCGGGGTTGGCACAGCAGCACGAGGCGCAGCAGCGCGATGCGGACCAGAGCGAGGTCGCGAAGG
CGATCAAGGCACGCAACGACGCGATTCGCGGCGACGCACCGGCGGGCGAGAACGACTTCCCGGAGTTGAA
GGAGCCGGACCTGGTGCTGGCGAGCGCAGCGGGCGTCAGTGTGGCGGCCGAGCGCGGCGCGCACGTGGCG
AGCAACGAGGACATCGCGATGACGAGCGGGCGGCATGTGGGGCTCGCGGTGGGTCACTCGCTGTTCGCGA
GCGTGTCGAACGCGTTTTCGCTGTTCGTGCACAAGGCGGGGATGAAACTGATCGCGGCTGCGGGCAAGGT
ACGCATCGAGGCGCAGACCGACGGCATCGACATGAAGGCGAAGCAGTCGGTGAAGATCGAGAGCACGACC
GACAGCATCGAGCTCCATGCCGCGAAGGAAATCGTGCTGCACGCGGGTAGCACGCAGATGCGGATCAGCG
ATCAGGGCTATACGGTCCATACCGCCGGCGAGCACACGATCCATGCAGGCAGTCACCAGACCGACGGGCC
GCAGGGACAGGGCGGAGGCTTCCCGCCGTTTCCGAAATCCGGGCCTGGACAACTGGAAGTGCTGCGCCAC
TACGTGACCGATGCACCGGTCGACAAGAACACCATCGCGGTGACGGACAGTCTTGGTGCGGTGCACAAAG
GGACGCTGGACGCATCCGGTCGAACCATTGTAAGCGGGTTGGCGCCGGGTGCAGTCACCGTGCAATACGG
GCACGACCCGCATGACTCCTGGGTCATGTCCAGCTACTTGAAGCAGCCTCGCTGGAACCCGGCAGGTGCT
GCCTGA