SecReT6
Protein ID: 330814653
SecReT6 ID434
T6SS typei3
Gene symbol-
Locus tagbgla_4p2340
StrainBurkholderia gladioli BSR3
Repliconplasmid bgla_4p [GenBank: NC_015383] [Browse all T6SS(s) in this replicon]
Location [Strand]247556..248821 [-]
ProductOmpA/MotB domain protein
NoteTssL
UniProt IDF2LSX6
KEGG IDbgd:bgla_4p2340
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 5.30E-43, Aligned region: 32..223
OmpA [PF00691], Evalue: 1.80E-11, Aligned region: 337..413
Protein Sequence: 421 a.a.     [Download]
>gi|330814653|ref|YP_004362828.1| OmpA/MotB domain protein [Burkholderia gladioli BSR3]
MTISKIDSRNYAGVLASPPLSARLKAALQSVNPLLESARVLLLALADTPAALEPDAVLQRRKWLEQELRM
FLRVCRDLQLPSDDVVRASYCLSTALDEAAMQTRWGRGEGTGTEWQASSLAVAMGHDRQGGDRVFHVIDE
VLNDPRGHLDLLELLQNVLDLGFRGRYRFERDGPRRLLNIHERVHGVVMAGEQGAAPVVDEDHTASRFAS
SDRVRGTVVSRGRLVDPWVRPARARRSRWWIDVGVVAVLLVGAAGYVAVRELRHADQSAQASSPIDRLGA
ALGEQLRDEIAAGNVELIKDTAADTVTLRFNGMYASGDVTVAPWWASVMASVGRAIASSPATTHVLITGY
TDNLPASPAHQGSNHALSTARAQQVAQIFAVAGVPKERISVVGQSDADPLADNVSKEGRARNRRVEVTVS
N
 
Nucleotide Sequence: 1266 bp     [Download]
>gi|330814453|ref|NC_015383.1|:c248821-247556 Burkholderia gladioli BSR3 plasmid bgla_4p, complete sequence
GTGACGATTTCGAAAATCGACTCGCGAAACTACGCCGGAGTTCTGGCGTCGCCGCCGCTCAGCGCGCGAC
TCAAGGCGGCGTTGCAATCGGTCAATCCGTTGCTTGAATCCGCACGCGTCTTGCTGCTCGCGCTGGCGGA
TACGCCCGCCGCACTGGAACCAGACGCCGTTTTGCAGCGGCGCAAATGGCTTGAGCAGGAATTGCGGATG
TTTTTGCGGGTTTGTCGCGATCTGCAGCTGCCGTCGGACGATGTCGTGCGGGCGAGCTATTGCCTCAGCA
CCGCGCTCGACGAGGCTGCGATGCAAACGCGTTGGGGACGGGGCGAGGGCACTGGAACCGAATGGCAGGC
CAGCAGTCTCGCGGTGGCGATGGGCCACGATCGACAAGGCGGCGATCGCGTTTTCCACGTGATCGACGAG
GTGCTGAACGACCCGCGCGGACATCTCGACCTGCTCGAGCTGTTGCAGAACGTCCTTGATCTTGGCTTTC
GCGGGCGATACCGCTTCGAGCGCGATGGTCCGCGACGGCTGCTGAACATCCACGAGCGCGTGCACGGCGT
GGTAATGGCAGGAGAGCAGGGCGCGGCCCCCGTTGTTGATGAAGACCATACGGCCAGTCGCTTCGCCTCA
TCCGATCGTGTTCGCGGGACGGTCGTTTCGCGCGGGCGCTTGGTCGATCCGTGGGTGCGTCCGGCTCGCG
CGCGTCGGTCACGCTGGTGGATTGACGTCGGTGTTGTGGCAGTGCTGTTGGTGGGCGCGGCAGGGTACGT
CGCGGTCAGGGAGTTGCGCCACGCGGATCAGTCCGCTCAGGCGTCGTCCCCGATCGATCGATTGGGCGCT
GCGTTGGGCGAGCAGCTGCGCGACGAAATTGCCGCCGGCAATGTGGAGTTGATAAAGGATACGGCGGCCG
ACACGGTGACGCTCAGATTCAACGGAATGTATGCGTCGGGCGACGTGACGGTGGCCCCATGGTGGGCGTC
CGTGATGGCATCGGTCGGACGGGCTATCGCGAGCTCGCCGGCTACCACCCACGTGCTCATCACCGGATAC
ACCGACAACCTGCCAGCGAGTCCCGCCCATCAGGGTTCGAATCACGCGCTGTCCACAGCCCGCGCCCAGC
AAGTTGCGCAGATTTTCGCGGTGGCCGGCGTGCCGAAGGAACGCATCAGCGTGGTGGGCCAGAGCGATGC
CGATCCACTGGCCGATAACGTGTCAAAGGAAGGGCGGGCGAGAAACCGTCGCGTCGAAGTGACCGTGTCG
AATTGA