SecReT6
Protein ID: 330814655
SecReT6 ID434
T6SS typei3
Gene symbol-
Locus tagbgla_4p2360
StrainBurkholderia gladioli BSR3
Repliconplasmid bgla_4p [GenBank: NC_015383] [Browse all T6SS(s) in this replicon]
Location [Strand]252934..254196 [-]
Producttype VI secretion system OmpA/MotB family protein
NoteTssL
UniProt IDF2LSX8
KEGG IDbgd:bgla_4p2360
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.40E-65, Aligned region: 46..255
OmpA [PF00691], Evalue: 9.70E-15, Aligned region: 314..412
Guanylate_cyc [PF00211], Evalue: 0.0032, Aligned region: 70..115
Protein Sequence: 420 a.a.     [Download]
>gi|330814655|ref|YP_004362830.1| type VI secretion system OmpA/MotB family protein [Burkholderia gladioli BSR3]
MSNSSTGTGVPEERAMPASVLPQSASSGGTVVPFRERLIAVEQACNPLREAARPLLRALADMPDRLAPEE
TFALRDLLEHEVRTFQKLCEQANIRRDHTIGARYCLCTALDEAATQTAWGKGGSSGIEWISSGLATTFHE
DRQGGQKIYLLIGRLLAEPREHLDLLEVIYEILSLGFEGRYRHEANGKRKHDAIRQRLYNEITSQRGIAP
TALSPHWQSDVKGKRVSFYDFPVWITVTLLSVVLLGLFGWFKYELMSRSAIVEKQIADIGRMTPPPAPPQ
LHLKQLLKDEIAAGTVSVDEDARHSAVTFRGDAMFPPGGVTIKSAMAPLVAKIAGEIVKVPGKVSVLGYT
DNLPIRSRQFPSNEALSEERATQVLQMLQAAGVPANRLEAVGKGDADPIGDNRTAQGRAQNRRVEIVVAQ
 
Nucleotide Sequence: 1263 bp     [Download]
>gi|330814453|ref|NC_015383.1|:c254196-252934 Burkholderia gladioli BSR3 plasmid bgla_4p, complete sequence
ATGAGCAATTCATCTACCGGCACCGGTGTGCCCGAGGAACGGGCGATGCCTGCCTCCGTTCTCCCGCAAT
CCGCTTCCTCCGGAGGGACTGTCGTTCCTTTTCGGGAGCGGCTCATTGCGGTCGAGCAGGCGTGCAATCC
GTTGCGGGAAGCCGCGCGGCCGCTCCTGCGTGCGCTCGCGGATATGCCGGACCGTCTCGCCCCCGAGGAG
ACCTTCGCGCTTCGAGACCTGCTCGAACATGAGGTGCGCACGTTCCAGAAGCTTTGCGAGCAGGCGAACA
TTCGGCGCGACCACACGATTGGCGCACGCTATTGCCTGTGTACGGCACTCGATGAGGCAGCAACGCAGAC
CGCATGGGGGAAGGGAGGATCGTCCGGGATCGAATGGATCAGCAGCGGCCTTGCCACCACGTTCCATGAG
GACCGTCAGGGTGGTCAGAAGATCTACCTTCTGATTGGCCGACTGCTTGCCGAACCGCGTGAACATCTGG
ACTTGCTGGAAGTCATCTACGAGATTCTCAGCCTCGGCTTCGAAGGGCGCTATCGGCACGAGGCGAACGG
CAAGCGCAAGCACGATGCGATTCGCCAGCGGCTCTACAACGAGATCACCTCGCAACGCGGGATCGCACCA
ACGGCGCTGTCGCCGCACTGGCAGTCGGATGTGAAAGGCAAACGGGTGTCTTTCTATGATTTTCCGGTCT
GGATCACCGTCACGCTGCTGTCGGTGGTCCTCCTCGGTCTGTTCGGCTGGTTCAAATACGAACTGATGAG
CCGAAGCGCGATCGTGGAGAAGCAGATCGCCGATATCGGCCGGATGACGCCGCCACCCGCACCGCCTCAA
TTGCATCTGAAGCAGTTGCTCAAGGACGAAATCGCGGCCGGCACCGTCAGCGTCGACGAGGATGCGCGTC
ACAGCGCCGTGACATTCCGTGGCGATGCGATGTTCCCGCCCGGTGGCGTCACGATCAAGAGTGCGATGGC
GCCGCTCGTCGCGAAAATCGCGGGCGAGATCGTGAAGGTGCCGGGCAAGGTCAGCGTCCTGGGGTACACG
GACAACCTGCCGATTCGCAGTCGCCAGTTCCCGTCGAACGAGGCGCTGTCGGAGGAGCGGGCGACGCAAG
TCTTGCAGATGCTGCAGGCCGCTGGTGTGCCCGCCAACCGCCTCGAAGCGGTGGGCAAGGGTGACGCCGA
TCCGATCGGCGACAACCGCACTGCCCAGGGTCGCGCGCAGAACCGGCGCGTCGAGATCGTCGTCGCGCAA
TAG