SecReT6
Protein ID: 330814656
SecReT6 ID434
T6SS typei3
Gene symbol-
Locus tagbgla_4p2370
StrainBurkholderia gladioli BSR3
Repliconplasmid bgla_4p [GenBank: NC_015383] [Browse all T6SS(s) in this replicon]
Location [Strand]254248..255594 [-]
Producttype VI secretion protein, family
NoteTssK
UniProt IDF2LSX9
KEGG IDbgd:bgla_4p2370
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 4.30E-141, Aligned region: 20..447
Protein Sequence: 448 a.a.     [Download]
>gi|330814656|ref|YP_004362831.1| type VI secretion protein, family [Burkholderia gladioli BSR3]
MSWYAKVAWQEGLFFRPQLFQQQDRYFEKYAHMRAAPLSPFFFGFSHYALDLESLALGKVIVKSAAGVFA
DGSPFDAPGNTPLPQPLTIRPEHLDQVIYLAVPVRLPNCEETTFENTPDSLARYLVFDTELRDTNSIGLA
PEPVQLSNLRLRLMPEKELGDAWIGLALTRVKTIRADGSIELDDTLVPPVSGYGASGLLTSWVTKIHDLA
RLRANALAQRLAGTDDTTASAATVTDYLLLQILNRYEPLLQHMLHVPTTSPADVYALMISMAGELSTHLR
TDTRRPLDTHPPYQHTTPHLCLKPVVDDTHRLLNAVLVRSAQSIALEDRGHGMRNAVVDPVDMQGFAAVV
LAVHAAMPPDVLQQQFLAQAKAGPSDKLPSLVRSHLPGIGLQALPVPPRQIPFNAGYIYYELTQGGPLWD
EVVRHGGLALHVAGDFPSIKLELWGVRA
 
Nucleotide Sequence: 1347 bp     [Download]
>gi|330814453|ref|NC_015383.1|:c255594-254248 Burkholderia gladioli BSR3 plasmid bgla_4p, complete sequence
ATGAGCTGGTACGCCAAGGTCGCCTGGCAGGAAGGGCTGTTTTTCCGTCCGCAACTGTTCCAGCAACAGG
ATCGCTACTTCGAGAAGTACGCGCACATGCGCGCGGCTCCGCTGTCACCGTTCTTCTTCGGCTTTTCGCA
CTACGCGCTCGATCTGGAGTCGCTGGCGCTCGGTAAGGTGATCGTCAAGTCCGCCGCCGGGGTGTTTGCC
GACGGTTCGCCGTTCGATGCACCGGGCAACACGCCGTTGCCGCAGCCGCTGACGATCCGGCCGGAACACC
TCGATCAGGTGATTTATCTGGCGGTGCCGGTCCGACTGCCGAACTGCGAAGAGACGACGTTCGAGAACAC
GCCGGATTCGCTGGCGCGCTACCTCGTGTTTGATACCGAGCTGCGCGACACGAATTCGATCGGCCTTGCG
CCTGAGCCGGTGCAACTTTCGAACCTCCGCCTGCGCCTGATGCCCGAAAAGGAGCTCGGCGATGCGTGGA
TCGGTCTTGCGCTGACGCGCGTGAAGACCATTCGTGCGGACGGCAGCATCGAGCTCGACGACACCTTGGT
ACCGCCCGTTTCGGGCTACGGGGCCAGCGGCTTGCTGACGAGCTGGGTGACGAAGATTCACGATCTCGCA
CGCCTGCGCGCGAATGCGCTCGCGCAGCGGCTGGCGGGTACCGATGACACCACGGCGAGCGCCGCGACGG
TCACCGACTATCTGCTGCTGCAGATCCTGAACCGGTATGAGCCGCTGCTGCAGCACATGCTGCACGTGCC
GACCACGTCACCCGCCGATGTGTATGCGCTGATGATCAGCATGGCCGGCGAATTGTCGACGCATCTGCGC
ACGGATACACGGCGGCCGCTCGACACGCATCCGCCATATCAGCACACGACACCGCACCTGTGTCTGAAGC
CGGTTGTCGACGATACGCATCGGCTGCTCAACGCCGTGCTGGTCCGCAGCGCGCAAAGCATCGCACTCGA
AGACCGTGGCCACGGCATGCGAAACGCCGTGGTCGATCCGGTCGACATGCAGGGGTTTGCTGCGGTCGTG
CTGGCCGTACACGCGGCCATGCCGCCGGACGTGCTGCAGCAGCAATTCCTTGCGCAGGCGAAGGCGGGCC
CGTCCGACAAGCTGCCGAGCCTCGTGCGCAGCCACCTGCCGGGCATTGGTTTGCAGGCGCTGCCGGTACC
GCCGCGACAGATTCCGTTCAACGCGGGCTATATCTATTACGAGCTGACCCAGGGCGGGCCGCTATGGGAC
GAGGTTGTCCGACACGGCGGTCTTGCGCTACACGTGGCCGGCGACTTCCCGTCGATCAAACTGGAACTGT
GGGGCGTACGCGCGTAA