SecReT6
Protein ID: 330814657
SecReT6 ID434
T6SS typei3
Gene symbol-
Locus tagbgla_4p2380
StrainBurkholderia gladioli BSR3
Repliconplasmid bgla_4p [GenBank: NC_015383] [Browse all T6SS(s) in this replicon]
Location [Strand]255626..256207 [-]
Producttype VI secretion lipoprotein, family
NoteTssJ
UniProt IDF2LSY0
KEGG IDbgd:bgla_4p2380
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 4.70E-45, Aligned region: 40..186
Protein Sequence: 193 a.a.     [Download]
>gi|330814657|ref|YP_004362832.1| type VI secretion lipoprotein, family [Burkholderia gladioli BSR3]
MERHAPGQNPAPAGCAAFPASFQRKFSMRSILTVVTLAGVVLLSACASGEPKPKEPIRLELTVNAQADVN
PDDRGRAAPIVVRLYELKNDNAFEAADFFTLQTQDKTVLADDVVKRDELQLRPGEHQTIVRRPAADTTVI
GVIAAYRDLPNSVWRTVYTMPALDKAWYSFSTPKLKLTVDLEAKAVKIEEAKK
 
Nucleotide Sequence: 582 bp     [Download]
>gi|330814453|ref|NC_015383.1|:c256207-255626 Burkholderia gladioli BSR3 plasmid bgla_4p, complete sequence
ATGGAACGCCACGCACCGGGCCAAAATCCAGCCCCCGCCGGCTGCGCGGCGTTTCCCGCTTCCTTTCAAC
GTAAATTCAGTATGCGTTCGATTCTGACTGTCGTCACGCTCGCCGGCGTTGTGTTGCTTTCGGCCTGTGC
GAGCGGCGAGCCGAAGCCCAAGGAGCCGATCCGGCTTGAACTGACCGTCAACGCCCAGGCCGACGTCAAC
CCGGACGACCGCGGCCGGGCCGCGCCGATCGTCGTACGCCTCTACGAGCTGAAAAACGACAACGCCTTCG
AGGCAGCAGATTTTTTTACGTTGCAGACGCAGGACAAGACGGTGCTGGCCGACGACGTCGTCAAGCGCGA
CGAGCTGCAATTGCGTCCCGGCGAGCACCAGACGATCGTGCGACGCCCGGCAGCGGACACGACCGTCATT
GGCGTGATCGCGGCCTATCGCGACCTGCCGAATTCGGTATGGCGGACCGTCTACACGATGCCTGCACTCG
ACAAGGCGTGGTACAGCTTCTCCACGCCGAAGCTGAAACTGACTGTCGATCTTGAAGCCAAGGCCGTCAA
GATCGAGGAAGCCAAAAAATGA