SecReT6
Protein ID: 330814658
SecReT6 ID434
T6SS typei3
Gene symbol-
Locus tagbgla_4p2390
StrainBurkholderia gladioli BSR3
Repliconplasmid bgla_4p [GenBank: NC_015383] [Browse all T6SS(s) in this replicon]
Location [Strand]256212..256697 [-]
Producttype VI secretion system effector, Hcp1 family
NoteTssD
UniProt IDF2LSY1
KEGG IDbgd:bgla_4p2390
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.10E-43, Aligned region: 6..136
Protein Sequence: 161 a.a.     [Download]
>gi|330814658|ref|YP_004362833.1| type VI secretion system effector, Hcp1 family [Burkholderia gladioli BSR3]
MAQDIFLKIDGINGESLDDKHKDEIEVLNWDWEILQESTMHAGSGGGAGKATVKDLTFEHNIDRASPNLM
KYALTGKHIDQATLVMRKAGGNPLEYLKVTMSDVIVTRVKPSGSKTDAEKSRETVSLSFAKVKQEYVVQN
AQGGSGGAVTASFDIKGNKEA
 
Nucleotide Sequence: 486 bp     [Download]
>gi|330814453|ref|NC_015383.1|:c256697-256212 Burkholderia gladioli BSR3 plasmid bgla_4p, complete sequence
ATGGCACAAGACATTTTCCTGAAGATCGACGGCATCAACGGCGAGTCGCTCGACGACAAGCACAAGGACG
AAATCGAAGTTCTGAACTGGGATTGGGAGATCCTGCAGGAATCGACGATGCACGCCGGCAGCGGCGGCGG
TGCGGGCAAGGCGACGGTCAAGGATCTGACGTTCGAACACAACATCGATCGCGCGAGCCCGAACCTGATG
AAGTACGCGCTGACGGGCAAACACATCGACCAGGCGACGCTCGTGATGCGCAAGGCCGGCGGCAACCCGC
TCGAGTACCTGAAAGTCACGATGAGCGACGTGATTGTTACGCGCGTGAAGCCGTCGGGCAGCAAGACCGA
TGCGGAGAAGAGCCGCGAGACGGTGTCCCTGTCGTTCGCGAAGGTGAAGCAGGAGTATGTCGTGCAGAAC
GCGCAAGGCGGAAGCGGCGGCGCCGTCACGGCGAGCTTCGACATCAAGGGCAACAAGGAAGCGTAA