SecReT6
Protein ID: 330814659
SecReT6 ID434
T6SS typei3
Gene symbol-
Locus tagbgla_4p2400
StrainBurkholderia gladioli BSR3
Repliconplasmid bgla_4p [GenBank: NC_015383] [Browse all T6SS(s) in this replicon]
Location [Strand]256786..258279 [-]
Producttype VI secretion protein, EvpB/family
NoteTssC
UniProt IDF2LSY2
KEGG IDbgd:bgla_4p2400
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.60E-193, Aligned region: 65..491
Protein Sequence: 497 a.a.     [Download]
>gi|330814659|ref|YP_004362834.1| type VI secretion protein, EvpB/family [Burkholderia gladioli BSR3]
MAKQQAQAVQAQIATQSDFTQLLEKEFRPKTEQAREAVEFAVQTLAEQALSQSITISDDAYKSIAAIIAQ
IDHKLSEQINLILHHEDYQALESAWRGLNHLVSNTETDEHLKIRVLDVSKTELHRTMRRYKGLAWDQSPL
FKQIYEQEYGQLGGEPYGCLVADYYFDHTPPDVDLLGSIAKVAAASHTPFITGAAPSVLQMESWQELANP
RDLTKIFTQNLEYAAWNSLRNTEDARYVGLAMPRFLARLPYGAKTNPVDEFDFEEDTNGSNHSRYGWANA
AYAMGVNINRSFKQYGWCSLIRGVESGGTVENLPCHTFPTDDGGVDMKCPTEIAISDRREAELSKNGFIP
LVHRKNTDHATFIGAQSLQKPAEYHDPDATANANLSARLPYLFACSRFAHYLKCIVRDKIGAFKEREDMQ
RWLNEWVMHYVDADPVNSSQDTKARRPLAAAEVLVEDVEGNPGYYQAKFFLRPHFQLEGLTVSLRLVTKL
PSIKEAA
 
Nucleotide Sequence: 1494 bp     [Download]
>gi|330814453|ref|NC_015383.1|:c258279-256786 Burkholderia gladioli BSR3 plasmid bgla_4p, complete sequence
ATGGCGAAACAGCAAGCACAGGCCGTCCAAGCGCAGATTGCCACCCAATCCGATTTTACGCAACTGCTCG
AGAAGGAATTCCGCCCGAAGACCGAGCAAGCACGTGAAGCGGTCGAATTTGCGGTTCAGACGCTCGCCGA
ACAGGCACTGAGCCAGTCGATCACGATCAGCGACGATGCGTATAAGAGCATCGCGGCCATCATCGCGCAG
ATCGATCACAAGCTCTCCGAGCAGATCAACCTGATTCTGCATCACGAGGACTACCAAGCGCTGGAGTCCG
CATGGCGCGGCCTGAACCATCTCGTCTCGAACACCGAGACAGATGAACACTTGAAGATCCGTGTCCTGGA
CGTTTCGAAGACCGAACTGCATCGCACGATGCGTCGCTACAAGGGCTTGGCGTGGGATCAAAGCCCGCTC
TTCAAGCAAATCTACGAGCAGGAATACGGTCAGCTCGGCGGCGAGCCGTACGGGTGTCTCGTCGCCGACT
ACTACTTCGACCATACGCCGCCCGATGTTGACCTGCTGGGCTCGATCGCGAAGGTCGCTGCAGCGTCGCA
TACGCCGTTTATCACGGGTGCGGCACCGTCGGTGCTCCAGATGGAGTCGTGGCAGGAACTGGCGAACCCG
CGTGATCTGACCAAGATCTTTACGCAGAACCTCGAATACGCAGCATGGAATTCGCTGCGCAACACCGAGG
ACGCGCGCTACGTCGGCCTCGCGATGCCGCGTTTCCTTGCTCGTCTGCCGTATGGTGCCAAGACCAATCC
GGTTGACGAGTTCGATTTCGAAGAAGACACGAATGGCTCGAACCATAGCCGCTATGGTTGGGCGAACGCT
GCATATGCGATGGGCGTCAACATCAACCGCTCGTTCAAACAGTATGGCTGGTGCTCGCTGATCCGCGGCG
TCGAGTCCGGCGGCACGGTCGAGAACCTGCCGTGCCACACGTTCCCGACCGACGACGGCGGCGTCGACAT
GAAGTGCCCGACTGAGATCGCGATCTCGGATCGCCGCGAGGCCGAACTGTCGAAGAACGGTTTCATTCCG
CTCGTGCATCGGAAGAACACCGACCACGCAACGTTCATCGGTGCGCAGTCGCTGCAAAAGCCGGCCGAGT
ATCACGATCCGGACGCGACTGCCAACGCGAACCTGTCGGCACGTCTGCCGTACCTGTTTGCATGCTCGCG
CTTCGCGCATTACCTGAAGTGCATCGTGCGCGACAAGATCGGCGCGTTTAAGGAACGCGAGGATATGCAG
CGCTGGCTCAACGAATGGGTCATGCACTACGTCGATGCCGATCCCGTGAACTCGTCGCAGGACACCAAGG
CGCGCCGGCCGCTCGCAGCCGCCGAGGTGCTCGTCGAGGACGTGGAAGGTAATCCCGGCTACTACCAGGC
GAAATTCTTCCTGCGTCCGCACTTCCAGCTCGAAGGGCTGACGGTTTCGCTGCGGCTCGTCACCAAGCTG
CCTTCGATCAAGGAAGCGGCTTGA