SecReT6
Protein ID: 330814660
SecReT6 ID434
T6SS typei3
Gene symbol-
Locus tagbgla_4p2410
StrainBurkholderia gladioli BSR3
Repliconplasmid bgla_4p [GenBank: NC_015383] [Browse all T6SS(s) in this replicon]
Location [Strand]258307..258849 [-]
Producttype VI secretion protein, family
NoteTssB
UniProt IDF2LSY3
KEGG IDbgd:bgla_4p2410
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 3.50E-61, Aligned region: 11..165
Protein Sequence: 180 a.a.     [Download]
>gi|330814660|ref|YP_004362835.1| type VI secretion protein, family [Burkholderia gladioli BSR3]
MSASSSSQKFIARNRAPRVQIEYDVEVYGSEKKVELPFVMGVLADLSGKHPSEPLPAVTDRRFLEIDIDN
FDERMKAIRPRVAFAVPNTLTGEGQMMVDMTFESMEDFSPAAIARKVEPLRQLLEARTQLANLQTYMDGK
SGAEALVTQLLQDPALLKSLAAAPKPERHDAGAADPSEAN
 
Nucleotide Sequence: 543 bp     [Download]
>gi|330814453|ref|NC_015383.1|:c258849-258307 Burkholderia gladioli BSR3 plasmid bgla_4p, complete sequence
ATGTCCGCTTCCAGCAGTTCGCAAAAGTTCATCGCGCGTAATCGTGCGCCGCGCGTGCAAATCGAGTACG
ACGTCGAGGTCTACGGGTCGGAGAAGAAGGTCGAGCTGCCGTTCGTGATGGGCGTGCTGGCCGATCTGTC
CGGCAAGCATCCCTCGGAGCCGCTTCCTGCCGTGACGGACCGACGATTCTTGGAAATCGATATTGACAAT
TTCGATGAGCGCATGAAGGCCATCCGGCCACGCGTCGCGTTCGCAGTGCCGAATACGCTGACGGGCGAAG
GCCAGATGATGGTCGACATGACGTTCGAGAGCATGGAGGACTTTTCGCCGGCGGCCATCGCCCGCAAGGT
CGAGCCGCTGCGTCAGCTGCTGGAAGCGCGCACGCAACTCGCCAACCTGCAAACGTACATGGATGGGAAG
TCGGGTGCAGAAGCGCTCGTCACGCAACTGCTGCAGGACCCCGCGCTGCTCAAGTCGCTGGCTGCGGCAC
CAAAGCCCGAGCGTCATGACGCGGGTGCGGCGGACCCGAGCGAAGCGAACTGA