SecReT6
Protein ID: 330814661
SecReT6 ID434
T6SS typei3
Gene symbol-
Locus tagbgla_4p2420
StrainBurkholderia gladioli BSR3
Repliconplasmid bgla_4p [GenBank: NC_015383] [Browse all T6SS(s) in this replicon]
Location [Strand]258889..261570 [-]
ProductATPase
NoteTssH
UniProt IDF2LSY4
KEGG IDbgd:bgla_4p2420
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.60E-37, Aligned region: 230..309
AAA_2 [PF07724], Evalue: 1.60E-37, Aligned region: 611..776
AAA [PF00004], Evalue: 1.40E-20, Aligned region: 232..364
AAA [PF00004], Evalue: 1.40E-20, Aligned region: 616..700
ClpB_D2-small [PF10431], Evalue: 5.40E-15, Aligned region: 783..855
AAA_5 [PF07728], Evalue: 2.70E-14, Aligned region: 232..255
AAA_5 [PF07728], Evalue: 2.70E-14, Aligned region: 330..362
AAA_5 [PF07728], Evalue: 2.70E-14, Aligned region: 615..724
Sigma54_activat [PF00158], Evalue: 5.10E-08, Aligned region: 227..312
Sigma54_activat [PF00158], Evalue: 5.10E-08, Aligned region: 615..715
AAA_16 [PF13191], Evalue: 1.80E-07, Aligned region: 32..77
AAA_16 [PF13191], Evalue: 1.80E-07, Aligned region: 209..253
AAA_16 [PF13191], Evalue: 1.80E-07, Aligned region: 273..310
AAA_16 [PF13191], Evalue: 1.80E-07, Aligned region: 367..451
AAA_16 [PF13191], Evalue: 1.80E-07, Aligned region: 611..658
AAA_16 [PF13191], Evalue: 1.80E-07, Aligned region: 680..703
AAA_16 [PF13191], Evalue: 1.80E-07, Aligned region: 778..815
AAA_22 [PF13401], Evalue: 2.60E-06, Aligned region: 232..312
AAA_22 [PF13401], Evalue: 2.60E-06, Aligned region: 418..481
AAA_22 [PF13401], Evalue: 2.60E-06, Aligned region: 614..638
AAA_22 [PF13401], Evalue: 2.60E-06, Aligned region: 677..704
AAA_17 [PF13207], Evalue: 5.10E-06, Aligned region: 232..271
AAA_17 [PF13207], Evalue: 5.10E-06, Aligned region: 615..653
Clp_N [PF02861], Evalue: 9.00E-06, Aligned region: 26..73
AAA_19 [PF13245], Evalue: 9.20E-06, Aligned region: 230..254
AAA_19 [PF13245], Evalue: 9.20E-06, Aligned region: 494..513
AAA_19 [PF13245], Evalue: 9.20E-06, Aligned region: 613..637
AAA_29 [PF13555], Evalue: 3.50E-05, Aligned region: 224..252
AAA_29 [PF13555], Evalue: 3.50E-05, Aligned region: 613..640
AAA_18 [PF13238], Evalue: 5.10E-05, Aligned region: 232..255
AAA_18 [PF13238], Evalue: 5.10E-05, Aligned region: 616..647
Zeta_toxin [PF06414], Evalue: 5.50E-05, Aligned region: 232..256
Zeta_toxin [PF06414], Evalue: 5.50E-05, Aligned region: 488..504
Zeta_toxin [PF06414], Evalue: 5.50E-05, Aligned region: 608..655
NACHT [PF05729], Evalue: 7.00E-05, Aligned region: 232..259
NACHT [PF05729], Evalue: 7.00E-05, Aligned region: 615..642
IstB_IS21 [PF01695], Evalue: 7.60E-05, Aligned region: 223..252
IstB_IS21 [PF01695], Evalue: 7.60E-05, Aligned region: 615..635
IstB_IS21 [PF01695], Evalue: 7.60E-05, Aligned region: 725..749
AAA_14 [PF13173], Evalue: 0.00017, Aligned region: 232..313
AAA_14 [PF13173], Evalue: 0.00017, Aligned region: 614..697
AAA_25 [PF13481], Evalue: 0.00019, Aligned region: 232..270
AAA_25 [PF13481], Evalue: 0.00019, Aligned region: 482..509
AAA_25 [PF13481], Evalue: 0.00019, Aligned region: 613..641
TIP49 [PF06068], Evalue: 0.0023, Aligned region: 232..254
TIP49 [PF06068], Evalue: 0.0023, Aligned region: 293..312
TIP49 [PF06068], Evalue: 0.0023, Aligned region: 614..650
RNA_helicase [PF00910], Evalue: 0.0032, Aligned region: 233..254
RNA_helicase [PF00910], Evalue: 0.0032, Aligned region: 616..637
NTPase_1 [PF03266], Evalue: 0.0037, Aligned region: 232..257
NTPase_1 [PF03266], Evalue: 0.0037, Aligned region: 615..637
T2SE [PF00437], Evalue: 0.0066, Aligned region: 221..252
T2SE [PF00437], Evalue: 0.0066, Aligned region: 606..684
UPF0079 [PF02367], Evalue: 0.0076, Aligned region: 232..253
UPF0079 [PF02367], Evalue: 0.0076, Aligned region: 613..641
Hpr_kinase_C [PF07475], Evalue: 0.0094, Aligned region: 232..244
Hpr_kinase_C [PF07475], Evalue: 0.0094, Aligned region: 613..633
Protein Sequence: 893 a.a.     [Download]
>gi|330814661|ref|YP_004362836.1| ATPase [Burkholderia gladioli BSR3]
MTISRQTLFGKLGVQLYRSIESATSFCKLRGNPFVELVHWLHQVLQQPDGDLQRIMRHAGIDRDALERDF
ARALAALPAGASSISDFSWHIESAIERAWVLATLEYDDRSVRGAWLIAALVSTPDLRRVLLSVSPAFGKI
PVDGLGDVLPAWIAGSPEAADGPYDHSELSPATPGEASGAMPGAQKSGSLEQYCTDLTAHARAGEIDPVI
GRELEIRTMIDVLLRRRQNNPLLTGEAGVGKTAVVEGLARAIASGNVPPNLGDVRLLSLDVGALLAGASM
KGEFEGRLKGLLEAAAKSPVPVIMFIDEIHTLIGAGGQAGTGDAANLLKPALARGTIRTIGATTWAEYKR
HIEKDPALTRRFQVLQVAEPSEAAAVDMVRGLVQTFSKHHGVVVRDEAIRGAVTLSHRYIPARQLPDKAI
SLLDTACARVALSQHATPRELDDVRQRLAAARTEEALLVQEARIGLDADNALTSVRARVDSMATEEAAVE
TRWREQAAAARALLAAREDAAAEAENSEMPLERLRELERALTTLQGDAPLVFPEVDEAIVAEIVSDWTGI
PVGRMVTDEVAAVRRLPETLEARVIGQSDALRVIGERVQTARAGLTDPKKPLGVFLLAGPSGVGKTETAL
ALAEALYGGEQNLITINMSEYQEAHTVSGLKGAPPGYVGYGEGGVLTEAVRRRPYSVVLLDEVEKAHRDV
HEMFFQVFDKGYMEDGDGRHIDFCNTTILLTSNVGSDLTASLCTDPALAPDMEGLRDALTPELIKAFPAA
FLGRVAVVPYRPLADDGLARIVRLHLGRVVKRMAESHDIALTFDDAVVDYIVGRCLVQETGARVLIGFID
QHILPRLSAVWLDAFTSKSSIARIAIGVADPAAAPPRALTFDALPIHLDASLG
 
Nucleotide Sequence: 2682 bp     [Download]
>gi|330814453|ref|NC_015383.1|:c261570-258889 Burkholderia gladioli BSR3 plasmid bgla_4p, complete sequence
ATGACGATTTCACGCCAAACGCTATTCGGTAAGCTCGGGGTTCAGCTCTACCGCAGCATCGAATCCGCAA
CGAGTTTTTGCAAACTGCGCGGAAACCCGTTCGTTGAGCTCGTCCACTGGCTGCATCAGGTGCTGCAGCA
GCCGGACGGCGACCTCCAACGGATCATGCGCCACGCGGGCATTGATCGGGATGCGCTCGAGCGCGATTTC
GCACGGGCGCTGGCCGCATTGCCGGCCGGCGCAAGCTCGATCAGCGATTTTTCGTGGCACATCGAATCGG
CAATCGAGCGTGCCTGGGTGCTCGCGACCCTCGAATACGATGACCGCAGTGTGCGCGGCGCATGGTTGAT
CGCGGCACTCGTGTCCACGCCCGACCTGCGACGTGTGCTGCTTTCCGTCTCTCCCGCGTTCGGCAAAATC
CCGGTCGACGGACTCGGTGATGTGCTGCCTGCCTGGATTGCTGGCTCCCCGGAAGCGGCCGACGGCCCCT
ACGACCACAGCGAGTTGTCGCCCGCCACGCCGGGTGAGGCGTCTGGTGCGATGCCGGGCGCGCAAAAGAG
CGGCTCCCTTGAGCAGTACTGCACGGATCTGACCGCGCACGCCCGAGCCGGCGAGATCGATCCGGTTATC
GGTCGCGAGCTCGAGATCCGCACGATGATCGACGTGCTGCTGCGCCGGCGGCAGAACAATCCGCTGCTGA
CCGGTGAAGCCGGCGTCGGCAAGACGGCGGTGGTGGAAGGCCTCGCTCGCGCGATCGCGTCGGGTAACGT
GCCACCGAACCTCGGTGACGTGCGCCTGTTGAGCCTCGACGTTGGTGCGCTGCTCGCCGGCGCCAGCATG
AAGGGTGAATTCGAGGGCCGCCTGAAGGGGCTGCTCGAAGCGGCCGCCAAGTCGCCCGTACCCGTGATCA
TGTTCATCGATGAGATCCATACGCTGATTGGCGCCGGCGGCCAGGCCGGCACGGGCGACGCTGCCAACCT
CCTGAAGCCGGCCCTCGCGCGCGGCACGATTCGCACGATTGGCGCGACCACGTGGGCCGAGTACAAGCGA
CATATCGAGAAAGACCCCGCATTGACCCGGCGCTTTCAGGTGCTGCAGGTTGCGGAGCCGTCGGAAGCCG
CTGCCGTCGATATGGTCCGTGGGCTTGTGCAAACGTTTTCAAAGCATCACGGAGTCGTGGTGCGCGATGA
GGCGATCCGCGGCGCGGTGACGCTGTCGCATCGCTACATTCCGGCGCGCCAGTTGCCGGACAAGGCGATC
AGCCTGCTCGATACCGCCTGCGCGCGGGTGGCGCTGTCGCAACATGCGACCCCGCGCGAGCTCGACGATG
TGCGTCAGCGGCTCGCTGCGGCGCGTACTGAAGAGGCACTGCTCGTGCAGGAGGCCCGTATCGGTCTGGA
TGCGGACAACGCATTGACCAGCGTGCGGGCGCGCGTCGACTCGATGGCGACCGAGGAGGCGGCGGTCGAG
ACTCGTTGGCGTGAGCAGGCTGCAGCGGCGCGAGCGTTGCTCGCCGCGCGTGAGGACGCTGCCGCAGAGG
CGGAAAATTCGGAGATGCCACTTGAACGGCTGCGTGAGCTCGAGCGCGCACTGACTACCCTTCAGGGCGA
TGCGCCGCTGGTGTTTCCCGAGGTCGACGAGGCGATCGTGGCAGAGATCGTGTCGGATTGGACCGGCATT
CCCGTCGGTCGTATGGTTACCGACGAGGTCGCGGCCGTACGCCGGCTGCCCGAAACGCTCGAAGCTCGCG
TGATCGGCCAGTCCGACGCGTTGCGCGTGATTGGCGAGCGCGTGCAGACAGCGCGGGCCGGCCTGACCGA
TCCGAAGAAGCCGCTCGGCGTGTTCCTGCTCGCTGGGCCGTCGGGTGTCGGCAAAACCGAAACGGCGCTC
GCGCTCGCGGAGGCGCTGTACGGTGGTGAGCAAAACCTGATCACGATCAACATGAGCGAGTATCAGGAAG
CCCACACCGTGTCGGGCCTGAAGGGCGCTCCGCCGGGCTACGTCGGTTACGGCGAGGGCGGTGTGCTGAC
CGAGGCTGTACGCCGGCGTCCGTACTCGGTTGTCCTGCTCGACGAGGTCGAGAAGGCCCATCGCGACGTA
CACGAAATGTTCTTCCAGGTATTCGACAAGGGCTACATGGAAGACGGCGACGGCCGCCACATCGATTTCT
GCAACACCACCATTCTGCTGACGAGCAATGTGGGCTCCGACCTGACCGCGAGCCTGTGCACCGATCCGGC
GCTGGCGCCTGACATGGAAGGTTTGCGGGACGCGCTCACGCCCGAACTGATCAAAGCGTTTCCGGCCGCC
TTTCTCGGTCGGGTGGCGGTGGTGCCGTACCGGCCGCTGGCCGACGACGGGCTTGCCCGCATCGTCCGCT
TGCATCTGGGCCGCGTCGTGAAGCGCATGGCCGAGAGCCACGATATCGCGCTTACCTTCGATGACGCGGT
GGTCGACTACATCGTCGGCCGTTGCCTCGTACAGGAGACCGGTGCGCGCGTGCTCATCGGCTTTATCGAT
CAACACATCCTGCCGCGCCTGTCCGCCGTCTGGCTCGACGCGTTCACGTCGAAGTCTTCGATTGCGCGCA
TTGCAATCGGTGTTGCCGATCCCGCTGCTGCGCCGCCGCGGGCGCTGACGTTCGATGCATTGCCTATCCA
TTTGGACGCGTCGCTCGGCTGA