SecReT6
Protein ID: 330814663
SecReT6 ID434
T6SS typei3
Gene symbol-
Locus tagbgla_4p2440
StrainBurkholderia gladioli BSR3
Repliconplasmid bgla_4p [GenBank: NC_015383] [Browse all T6SS(s) in this replicon]
Location [Strand]262777..263628 [+]
Productvirulence protein, SciE type
NoteTagJ
UniProt IDF2LSY6
KEGG IDbgd:bgla_4p2440
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 9.70E-49, Aligned region: 148..267
Protein Sequence: 283 a.a.     [Download]
>gi|330814663|ref|YP_004362838.1| virulence protein, SciE type [Burkholderia gladioli BSR3]
MTRLTASDTPHTHRLGEAPLSEQIERVSARLRAQPTTASHRWALFQLMCVTGEWTRAVQQLQTWAKLEPS
QAPTAQVYRDLIRAERWRKQVVEGRERPGFVLEPPAWVDGLLNALRFAADGQIEHADDAREAALDAAPSV
AVRIPQGNAAWIVDSDSSFGPVCEVITAGHYRWVPFADLVAWRVSPPTKLVDLVWAPCTLTLVDGAIVHG
FMPARYPDSETGDDAMRLGRSTVWLENGRTGITALGQKTWATDQGDFSLFELTSTEFGARIADGVSSGER
VGD
 
Nucleotide Sequence: 852 bp     [Download]
>gi|330814453|ref|NC_015383.1|:262777-263628 Burkholderia gladioli BSR3 plasmid bgla_4p, complete sequence
ATGACCCGGCTCACCGCCTCCGACACGCCTCACACCCATCGCTTGGGTGAAGCGCCCCTCAGCGAGCAAA
TCGAGCGCGTTTCGGCACGCCTACGTGCTCAGCCGACCACCGCGTCCCATCGTTGGGCGCTGTTCCAGTT
GATGTGCGTCACAGGTGAATGGACGCGCGCGGTTCAGCAGTTGCAGACGTGGGCGAAGCTTGAGCCGAGC
CAGGCGCCGACCGCGCAGGTGTACCGCGACTTGATCCGCGCCGAGCGCTGGCGAAAGCAGGTGGTCGAGG
GACGCGAACGCCCAGGCTTTGTGCTCGAGCCGCCAGCGTGGGTTGACGGTCTGCTGAACGCTCTCCGCTT
TGCTGCCGACGGACAGATCGAGCACGCGGACGACGCGCGTGAGGCAGCACTTGACGCCGCGCCGAGCGTC
GCGGTCCGTATCCCCCAGGGAAATGCGGCCTGGATCGTCGATAGCGATTCCAGTTTCGGCCCCGTCTGCG
AGGTCATCACGGCTGGGCACTACCGATGGGTTCCGTTTGCCGATCTGGTGGCATGGCGCGTGTCGCCGCC
GACGAAGCTGGTCGATCTGGTTTGGGCACCGTGTACGCTCACGCTCGTCGACGGCGCGATCGTCCACGGC
TTCATGCCGGCCCGGTACCCGGATTCGGAAACTGGCGACGACGCCATGCGCCTCGGACGTAGCACGGTCT
GGCTAGAAAATGGGCGAACCGGCATCACCGCACTCGGGCAAAAGACCTGGGCAACGGATCAGGGCGACTT
CAGTCTGTTCGAATTGACGAGCACCGAGTTCGGCGCGCGAATCGCCGACGGCGTCAGCAGCGGGGAGCGT
GTCGGTGACTGA