SecReT6
Protein ID: 330814664
SecReT6 ID434
T6SS typei3
Gene symbol-
Locus tagbgla_4p2450
StrainBurkholderia gladioli BSR3
Repliconplasmid bgla_4p [GenBank: NC_015383] [Browse all T6SS(s) in this replicon]
Location [Strand]263621..264181 [+]
Producthypothetical protein
NoteTssE
UniProt IDF2LSY7
KEGG IDbgd:bgla_4p2450
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.60E-20, Aligned region: 51..164
Protein Sequence: 186 a.a.     [Download]
>gi|330814664|ref|YP_004362839.1| hypothetical protein bgla_4p2450 [Burkholderia gladioli BSR3]
MTEHRKRPPGPDALAVRTPRRVNSHLMPTLLDRLRDDAPHRQVEATEEYTVTRKQMRDIVQRDLAYLLNT
TSIEDQIDRTRHPHAAASTVNFGVPPLAGAFITSRQWNDVERMIRQAITDFEPRLIPDSLVVAPRPGNDA
AGEHHNVLAFEVRGLIHMDPYPLEFMVQSSLDLETSEIRITGMRTS
 
Nucleotide Sequence: 561 bp     [Download]
>gi|330814453|ref|NC_015383.1|:263621-264181 Burkholderia gladioli BSR3 plasmid bgla_4p, complete sequence
GTGACTGAACACAGGAAACGTCCGCCTGGGCCAGATGCGCTGGCGGTCCGTACGCCTCGGCGGGTCAATT
CGCACCTGATGCCAACCCTGCTCGACCGGCTGCGCGACGACGCGCCACATCGGCAAGTCGAAGCGACGGA
GGAATATACGGTCACCCGCAAACAGATGCGGGACATCGTGCAGCGCGACCTCGCCTATCTCCTCAACACA
ACGAGCATCGAGGACCAGATCGATCGCACGCGCCATCCACATGCGGCAGCATCGACTGTGAATTTTGGTG
TGCCGCCGCTCGCAGGAGCCTTTATCACGTCGCGCCAGTGGAACGACGTCGAGCGCATGATCCGGCAGGC
CATCACGGATTTCGAGCCGCGGTTGATTCCAGATTCGCTTGTGGTGGCCCCTCGCCCCGGCAATGACGCC
GCCGGCGAGCATCACAATGTCCTCGCGTTCGAAGTTCGCGGCCTGATTCACATGGATCCGTACCCGCTCG
AATTCATGGTCCAAAGCTCGCTGGATCTCGAAACCAGCGAGATTCGAATCACCGGCATGCGCACCAGCTA
A