SecReT6
Protein ID: 330814665
SecReT6 ID434
T6SS typei3
Gene symbol-
Locus tagbgla_4p2460
StrainBurkholderia gladioli BSR3
Repliconplasmid bgla_4p [GenBank: NC_015383] [Browse all T6SS(s) in this replicon]
Location [Strand]264220..266109 [+]
Producthypothetical protein
NoteTssF
UniProt IDF2LSY8
KEGG IDbgd:bgla_4p2460
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 6.50E-219, Aligned region: 5..628
Protein Sequence: 629 a.a.     [Download]
>gi|330814665|ref|YP_004362840.1| hypothetical protein bgla_4p2460 [Burkholderia gladioli BSR3]
MDPRLLDYYNQELIYMRELAAEFAHAHPKIARRLGMQAGEVADPYVERLIESFSFMAARMQIKLDAEFPR
FTERLLEVIYPNYVAPTPSIGVARLYPGRTEGNLANGYRIARGTAFTARIPDGERTACQFTSGQDVTLWP
LTITEARLTGIPPDIPGLARYVPPDTQVRGALRLRLATTGDVRISDLKGLDRLPVYLAGDEQVASHLFEL
LHVGAIASVIGAPGEFGAPGRPPVAVTENAVEHEGLRTDQNLLPLTWTKFHGHNLLHEYFACPARFWFFA
LTGLAEGLSRVDGREVEIVVLLDRAPAELANLVDASRFALFCTPVINLFSKHTDRIEISPRETEFHLVPA
RLAPLDYEVFSVETVYGRVAATSAELEFRPLYQTLNNDEGNHGRYFSTRRERRLVSDSARRYGTRTPYVG
TEVFLSLVDQNEAPYNENIRFLSVDALLTNRDLATLVPRDGVHDLETAESAPVESIGLIRAPSPPLPPYA
ERDMAWRLIRQLNFNYLPLGDLDHREGGQGLRDLLRLYLADGDSGQGRQVESLVGVKTRPVTRKLPGAGP
MTFGRGIECALTVDETGFSGVSPYLFGVILEHWLARHVSINSFTQTELHSMQRGRIARWPVRTGTRGAL
 
Nucleotide Sequence: 1890 bp     [Download]
>gi|330814453|ref|NC_015383.1|:264220-266109 Burkholderia gladioli BSR3 plasmid bgla_4p, complete sequence
ATGGACCCGCGACTGCTCGACTACTACAACCAAGAACTCATCTACATGCGCGAACTGGCTGCAGAATTCG
CGCATGCGCACCCGAAGATCGCGCGGCGCCTGGGCATGCAGGCGGGCGAGGTGGCCGATCCCTACGTCGA
GCGTCTGATCGAGTCGTTCAGCTTCATGGCTGCACGCATGCAGATTAAGCTCGACGCGGAGTTTCCGCGC
TTTACCGAGCGGCTCCTCGAGGTCATCTACCCGAACTACGTCGCACCCACACCGTCGATTGGCGTCGCCC
GCCTGTACCCGGGCCGGACCGAAGGCAACCTCGCCAACGGATATCGCATCGCGCGCGGCACCGCATTCAC
CGCGCGCATTCCCGACGGCGAACGAACGGCGTGCCAGTTCACGAGCGGCCAGGACGTGACGCTGTGGCCG
CTCACGATTACCGAAGCGCGCCTGACTGGTATCCCGCCGGACATTCCGGGGCTCGCGCGATACGTCCCGC
CCGATACGCAGGTGCGCGGCGCCTTGCGGCTGCGGCTCGCGACAACCGGTGACGTCCGAATCTCTGACCT
GAAGGGGCTCGACCGTCTCCCCGTCTATCTGGCCGGTGATGAGCAAGTCGCCTCTCACCTGTTCGAGCTG
CTGCATGTCGGGGCAATCGCCTCCGTGATTGGCGCGCCCGGTGAGTTCGGTGCACCGGGCCGTCCACCCG
TGGCGGTCACCGAAAACGCCGTGGAGCACGAAGGCCTGCGCACCGACCAGAATCTCTTGCCGCTGACGTG
GACGAAATTTCACGGGCACAACCTGTTGCACGAGTATTTCGCGTGCCCTGCACGGTTCTGGTTCTTCGCG
TTGACTGGTCTGGCCGAGGGCCTGTCGAGGGTGGACGGGCGCGAGGTTGAAATCGTCGTGCTGCTCGACC
GCGCGCCGGCCGAGCTCGCGAACCTCGTCGACGCCTCGCGCTTCGCGCTGTTCTGCACGCCTGTCATCAA
TCTCTTCAGCAAACACACTGACCGGATCGAGATCTCTCCGCGCGAAACCGAGTTTCATCTGGTGCCGGCG
CGGCTCGCGCCCCTCGATTACGAGGTGTTCTCGGTGGAAACCGTATACGGTCGCGTGGCCGCGACGTCTG
CCGAGCTTGAGTTCCGGCCGCTGTACCAGACGCTGAACAACGATGAAGGTAACCACGGTCGCTACTTTTC
GACGCGGCGCGAACGACGGCTCGTGTCCGATTCAGCCCGCCGCTACGGTACGCGCACGCCCTACGTCGGC
ACAGAAGTGTTTCTCTCGCTTGTCGACCAGAACGAGGCGCCCTATAACGAGAACATCCGCTTTTTGTCGG
TCGACGCGCTCCTGACGAACCGCGATCTCGCCACGCTCGTGCCGCGCGATGGGGTGCACGACCTGGAGAC
CGCCGAGTCCGCCCCGGTCGAGAGCATTGGCCTAATCCGAGCACCGAGTCCGCCGCTGCCGCCGTATGCC
GAGCGCGACATGGCCTGGCGTTTGATCCGCCAGCTCAATTTCAACTACCTGCCGCTCGGCGATCTAGATC
ATCGAGAAGGCGGTCAGGGTCTGCGTGATCTGCTTCGCCTGTACCTTGCGGACGGCGATTCCGGACAAGG
CCGGCAAGTGGAAAGCCTCGTCGGCGTGAAAACGCGCCCGGTGACGCGCAAGCTGCCGGGGGCTGGCCCG
ATGACGTTCGGGCGCGGCATCGAGTGCGCGCTGACCGTCGACGAAACAGGCTTCTCCGGTGTGAGCCCCT
ATCTCTTTGGGGTCATTCTTGAGCACTGGCTCGCACGGCACGTCTCGATCAACAGCTTTACGCAAACCGA
ATTGCATTCAATGCAGCGCGGCCGCATTGCGCGCTGGCCCGTGCGCACTGGCACGCGCGGAGCACTGTGA