SecReT6
Protein ID: 330814667
SecReT6 ID434
T6SS typei3
Gene symbol-
Locus tagbgla_4p2480
StrainBurkholderia gladioli BSR3
Repliconplasmid bgla_4p [GenBank: NC_015383] [Browse all T6SS(s) in this replicon]
Location [Strand]267179..268297 [+]
ProductImpA-like protein
NoteTssA
UniProt IDF2LSZ0
KEGG IDbgd:bgla_4p2480
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 5.40E-20, Aligned region: 71..130
ImpA-rel_N [PF06812], Evalue: 5.40E-20, Aligned region: 221..233
Protein Sequence: 372 a.a.     [Download]
>gi|330814667|ref|YP_004362842.1| ImpA-like protein [Burkholderia gladioli BSR3]
MSKKQSAVHSKPGQAPVTTAPHFDWLMPVSDGAPCGPDLEYDHDFVVLFAGAAPRQDVQYGAFVGGPEPL
NWSEIDRDCRRLMLRTKDMRVAVLYTRCRARLGGAVGLAEGTGLLATWLQTFPDAIHPQAGVDDDREAAL
DMRMNALQGLADPDGLLTDVREIVLMKSTATRLQVRDVERAFAHPRPADAIAPDSVEQQLQDLRLQQPAT
MSAFDEAISNLAAINMWCAAHLESYLPDFSSLMRLLQLLQQGESHIESAPDDTSTFGAADPDGNTSEEAH
AAESLPAQLNGEGLDTAQPPSVASRAGGAPSDRQAALALISAARDWFETNEPSSPVPVLLKRAEQFVGKR
YAEAVKAIPADLLAQWDEAEGP
 
Nucleotide Sequence: 1119 bp     [Download]
>gi|330814453|ref|NC_015383.1|:267179-268297 Burkholderia gladioli BSR3 plasmid bgla_4p, complete sequence
ATGAGCAAGAAGCAATCTGCCGTGCACAGCAAACCCGGCCAGGCCCCCGTCACGACAGCGCCGCACTTCG
ACTGGCTCATGCCCGTGAGCGACGGCGCGCCCTGCGGCCCGGATCTCGAATACGACCATGATTTCGTCGT
CCTATTCGCGGGCGCTGCGCCCAGGCAGGACGTGCAGTACGGCGCGTTCGTCGGCGGACCCGAACCGCTC
AACTGGAGCGAAATCGATCGGGACTGCCGGCGCCTGATGCTCCGCACGAAGGACATGCGTGTGGCCGTGC
TCTACACGCGTTGCCGCGCGCGCTTGGGCGGTGCGGTGGGGCTCGCGGAAGGGACGGGACTGCTCGCCAC
CTGGCTGCAGACGTTTCCGGACGCCATCCATCCACAGGCGGGCGTTGACGACGATCGCGAGGCCGCGCTC
GACATGCGAATGAACGCGTTGCAGGGTCTCGCGGACCCGGACGGGCTGCTGACCGACGTGCGCGAAATCG
TGCTGATGAAGTCGACCGCCACGCGACTGCAGGTACGGGACGTTGAGCGCGCGTTCGCGCATCCGCGCCC
GGCCGACGCCATCGCACCCGACTCGGTCGAGCAGCAGCTGCAGGATCTACGTCTGCAACAGCCGGCGACC
ATGTCGGCCTTCGACGAGGCAATTTCGAACCTCGCCGCGATCAACATGTGGTGCGCCGCCCATCTTGAAT
CGTACCTGCCCGACTTCTCGTCATTGATGCGCCTCCTTCAGCTGCTGCAGCAAGGCGAATCGCACATTGA
ATCCGCACCGGATGACACATCGACATTCGGTGCCGCCGATCCCGATGGGAACACGTCGGAAGAAGCGCAT
GCGGCGGAATCCCTGCCGGCGCAACTCAACGGCGAGGGCCTCGACACGGCCCAACCGCCATCCGTCGCGT
CGCGCGCCGGCGGCGCGCCCAGCGACCGCCAGGCGGCTCTGGCATTGATCAGTGCAGCACGAGACTGGTT
CGAGACAAATGAACCCAGCAGCCCCGTCCCGGTCTTGCTCAAGCGCGCCGAACAGTTTGTCGGCAAACGC
TACGCGGAAGCTGTCAAGGCCATCCCCGCCGACCTTCTGGCGCAATGGGACGAGGCCGAAGGCCCGTGA