SecReT6
Protein ID: 330819514
SecReT6 ID430
T6SS typei3
Gene symbol-
Locus tagbgla_2g03880
StrainBurkholderia gladioli BSR3
Repliconchromosome II [GenBank: NC_015376] [Browse all T6SS(s) in this replicon]
Location [Strand]488136..488657 [+]
Producthypothetical protein
NoteTssB
UniProt IDF2LJJ7
KEGG IDbgd:bgla_2g03880
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.80E-60, Aligned region: 11..164
Protein Sequence: 173 a.a.     [Download]
>gi|330819514|ref|YP_004348376.1| hypothetical protein bgla_2g03880 [Burkholderia gladioli BSR3]
MATRQSSQKFIARNRAPRVQIEYDVELYGAQKKVQIPFVMGVMSDLSGANAGELPPIEERKALEIDVDNF
DSRMQSMKPRVNFTVPNTLTGEGNLEVDISFESMDDFSPAAVARKVDSLARLLEARTQLANLGTYLDGKV
GAEKLIAQALKDPALLQSLSSAPKAADTEPGQE
 
Nucleotide Sequence: 522 bp     [Download]
>gi|330819133|ref|NC_015376.1|:488136-488657 Burkholderia gladioli BSR3 chromosome 2, complete sequence
ATGGCAACGAGGCAGAGCAGTCAGAAATTCATTGCGCGCAATCGGGCGCCGCGCGTCCAGATCGAGTACG
ACGTCGAGTTGTACGGCGCGCAGAAGAAAGTGCAGATCCCGTTCGTGATGGGCGTGATGTCGGACCTGTC
CGGCGCCAATGCCGGCGAGCTGCCGCCGATCGAGGAGCGCAAGGCGCTCGAGATCGACGTCGACAACTTC
GACAGCCGCATGCAGTCGATGAAGCCGCGGGTCAACTTCACGGTGCCGAACACGCTGACCGGCGAAGGCA
ACCTCGAGGTCGACATCAGCTTCGAGAGCATGGACGACTTCTCGCCGGCCGCGGTGGCGCGCAAGGTGGA
TTCGCTCGCCAGGCTGCTCGAGGCGCGCACCCAGCTGGCCAATCTCGGCACCTATCTCGACGGCAAGGTC
GGCGCGGAGAAGCTGATCGCGCAGGCGCTGAAGGACCCGGCGCTGCTGCAGTCGCTGAGCTCGGCGCCCA
AGGCCGCCGACACCGAACCCGGACAGGAGTGA