SecReT6
Protein ID: 330819515
SecReT6 ID430
T6SS typei3
Gene symbol-
Locus tagbgla_2g03890
StrainBurkholderia gladioli BSR3
Repliconchromosome II [GenBank: NC_015376] [Browse all T6SS(s) in this replicon]
Location [Strand]488657..490159 [+]
Producttype VI secretion protein, EvpB/VC_A0108 family
NoteTssC
UniProt IDF2LJJ8
KEGG IDbgd:bgla_2g03890
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.80E-190, Aligned region: 69..495
BMFP [PF04380], Evalue: 0.0068, Aligned region: 22..62
LMP [PF04778], Evalue: 0.0079, Aligned region: 21..131
Protein Sequence: 500 a.a.     [Download]
>gi|330819515|ref|YP_004348377.1| type VI secretion protein, EvpB/VC_A0108 family [Burkholderia gladioli BSR3]
MAIMESQKQFEGAPQGAVAEANDFAALLNKEFKPKNERAKEEVEAAVRTLAEQVLRDSNVVSDDVTQTIN
AYVAEIDRKLSEQLNHVLHHAEFQKLEGAWRGLHHLVTNSETDPMLKIRVMNISKKELAKNLKRFKGVAW
DQSPVFKRVYEEEYGQLGGEPYGCLIGDYYFDHSPQDVELLRGISQIAAASHAPFISAADSSLLGMENWN
ELANPRDLSMIFTTPDYAGWRSLREMDDARYLALTMPRTLARLPYGAKTDPVEEFDFEEDTEGADSGKYT
WQNAAYSMAVNINRSFKLYGWCTRIRGVESGGAVENLPVHTFPSDDGGVDMKCPTEIAITDRRSAELDKM
GLMPLVHRKNSDVAAFIGAQSVAKPEEYDDPAATANSNLSARLPYMFACCRFAHYLKCIVRDKIGSFSTR
EQMENWLSNWVMNYVDGDPVNSSEETKARKPLAAAQVVVEEVEDNPGYYTSKFFLKPHYQLEGLTVSLRL
VSRLPSARAA
 
Nucleotide Sequence: 1503 bp     [Download]
>gi|330819133|ref|NC_015376.1|:488657-490159 Burkholderia gladioli BSR3 chromosome 2, complete sequence
ATGGCGATCATGGAAAGCCAGAAGCAATTCGAAGGCGCGCCGCAGGGCGCGGTGGCCGAGGCGAACGATT
TCGCGGCGCTGCTGAACAAGGAGTTCAAGCCCAAGAACGAGCGCGCCAAGGAGGAAGTGGAAGCCGCGGT
GCGCACGCTCGCCGAGCAGGTGCTGCGCGATTCGAACGTGGTCTCGGACGACGTCACGCAGACCATCAAC
GCCTACGTGGCCGAGATCGACCGCAAGCTCAGCGAGCAGTTGAACCACGTGCTGCACCACGCCGAATTCC
AGAAGCTGGAAGGTGCCTGGCGCGGCCTGCATCACCTGGTCACCAATTCCGAAACGGATCCGATGCTGAA
GATCCGCGTGATGAACATCTCGAAGAAGGAACTGGCCAAGAACCTCAAGCGCTTCAAGGGCGTGGCCTGG
GACCAGAGCCCGGTGTTCAAGCGCGTCTACGAGGAAGAATACGGCCAGCTCGGCGGCGAGCCCTACGGCT
GCCTGATCGGCGATTACTACTTCGACCACAGTCCTCAGGACGTCGAACTGCTGCGCGGCATCTCGCAGAT
CGCCGCGGCCTCGCACGCGCCCTTCATCTCGGCGGCCGATTCCAGCCTGCTCGGCATGGAGAACTGGAAC
GAGCTGGCGAACCCGCGCGACCTGTCGATGATCTTCACCACGCCCGACTACGCCGGCTGGCGCTCGCTGC
GCGAGATGGACGACGCGCGCTACCTGGCGCTGACCATGCCGCGCACGCTGGCGCGCCTGCCCTACGGCGC
GAAGACCGACCCGGTGGAGGAATTCGATTTCGAGGAAGACACCGAAGGCGCGGACTCGGGCAAGTACACC
TGGCAGAACGCGGCCTATTCGATGGCGGTCAACATCAACCGCTCGTTCAAGCTCTATGGCTGGTGCACGC
GGATTCGCGGCGTGGAATCGGGCGGCGCGGTGGAGAACCTGCCGGTGCATACCTTCCCGAGCGACGACGG
CGGGGTGGACATGAAGTGCCCGACCGAGATCGCGATCACCGACCGCCGCTCGGCCGAGCTCGACAAGATG
GGCCTGATGCCGCTGGTGCATCGCAAGAACTCCGACGTGGCCGCCTTCATCGGCGCGCAGTCGGTGGCCA
AGCCCGAGGAATACGACGATCCGGCCGCCACCGCCAACTCGAACCTGTCGGCGCGCCTGCCCTACATGTT
CGCCTGCTGCCGCTTCGCGCACTACCTGAAGTGCATCGTGCGCGACAAGATCGGCTCGTTCAGCACGCGC
GAGCAGATGGAGAACTGGCTGTCGAACTGGGTGATGAACTACGTCGACGGCGACCCGGTGAACTCCAGCG
AGGAAACCAAGGCGCGCAAGCCGCTGGCGGCCGCTCAGGTGGTGGTGGAGGAAGTCGAGGACAACCCCGG
CTACTACACCTCCAAGTTCTTCCTCAAGCCGCATTACCAGCTCGAAGGCCTGACGGTGTCGCTGCGCCTG
GTCTCGCGCCTGCCCTCGGCACGCGCCGCATGA