SecReT6
Protein ID: 330819516
SecReT6 ID430
T6SS typei3
Gene symbol-
Locus tagbgla_2g03900
StrainBurkholderia gladioli BSR3
Repliconchromosome II [GenBank: NC_015376] [Browse all T6SS(s) in this replicon]
Location [Strand]490281..490784 [+]
Producthypothetical protein
NoteTssD
UniProt IDF2LJJ9
KEGG IDbgd:bgla_2g03900
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 8.10E-34, Aligned region: 7..141
Protein Sequence: 167 a.a.     [Download]
>gi|330819516|ref|YP_004348378.1| hypothetical protein bgla_2g03900 [Burkholderia gladioli BSR3]
MAFDMHLKFGSGSVTIQGASNHAKHKNEVPIIAWSWGVSNTGNLHTGAGYASGGKANIQDITVTKYIDSC
SNAILNACCTGARVDNAYLYVTNATGQQTDFVTIELSEGVLITSVSTGGTGGDERLTENITLHFGKFKYS
FQPQDDEGKANGGTKDFTYDIQQVAKQ
 
Nucleotide Sequence: 504 bp     [Download]
>gi|330819133|ref|NC_015376.1|:490281-490784 Burkholderia gladioli BSR3 chromosome 2, complete sequence
ATGGCATTCGACATGCACCTGAAATTCGGCTCCGGTTCGGTCACGATCCAGGGCGCGTCCAACCACGCGA
AGCACAAGAACGAGGTGCCGATCATCGCCTGGTCGTGGGGCGTGAGCAACACCGGCAACCTGCACACCGG
CGCCGGCTACGCTTCGGGCGGCAAGGCCAACATCCAGGACATCACGGTCACCAAGTACATCGACAGCTGC
TCGAACGCGATCCTGAACGCCTGCTGTACCGGCGCGCGCGTCGACAACGCCTACCTGTACGTGACCAACG
CCACCGGCCAGCAAACCGACTTCGTGACCATCGAGCTCAGCGAAGGCGTGCTGATCACCTCGGTGTCGAC
CGGCGGCACCGGCGGCGACGAGCGCCTGACCGAGAACATCACGCTGCACTTCGGCAAGTTCAAGTACTCG
TTCCAGCCGCAGGACGACGAGGGCAAGGCCAACGGCGGCACCAAGGATTTCACCTACGACATCCAGCAGG
TCGCCAAGCAGTAA