SecReT6
Protein ID: 330819517
SecReT6 ID430
T6SS typei3
Gene symbol-
Locus tagbgla_2g03910
StrainBurkholderia gladioli BSR3
Repliconchromosome II [GenBank: NC_015376] [Browse all T6SS(s) in this replicon]
Location [Strand]490859..491680 [+]
Producthypothetical protein
NoteTagJ
UniProt IDF2LJK0
KEGG IDbgd:bgla_2g03910
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 5.20E-40, Aligned region: 147..270
TPR_16 [PF13432], Evalue: 0.0019, Aligned region: 13..70
TPR_16 [PF13432], Evalue: 0.0019, Aligned region: 85..92
TPR_16 [PF13432], Evalue: 0.0019, Aligned region: 111..129
TPR_19 [PF14559], Evalue: 0.0066, Aligned region: 16..73
Protein Sequence: 273 a.a.     [Download]
>gi|330819517|ref|YP_004348379.1| hypothetical protein bgla_2g03910 [Burkholderia gladioli BSR3]
MNPTLADTSPADAAALLAHGRLDEALSALSAEVRGRPADASLRVFLFQLLALVGEWDRAANQLKMAAELD
ERNTLMSTAYEFALRGEHERAAVLAGGKCPGIAGEPAAWHAPLIRALHALTEKRIDETLAQRALAFDTAE
TVAGSIDGEPFEWIADADPRFGPCLELILKSGYVWAPFSQLRSLEFEAPSDLRDKVWAPVKLSWTSGAES
VGFVPCRYAGSERSGIADLALAAGTSWFEHGEDCFTGRGQRMLVTDRAEYPLLDVRSITFGAR
 
Nucleotide Sequence: 822 bp     [Download]
>gi|330819133|ref|NC_015376.1|:490859-491680 Burkholderia gladioli BSR3 chromosome 2, complete sequence
GTGAACCCAACCCTTGCCGACACCAGCCCGGCCGACGCCGCGGCGCTGCTTGCCCATGGACGCCTGGACG
AGGCCCTGAGCGCCCTGTCCGCCGAGGTCCGCGGCCGACCCGCCGATGCCTCGCTGCGCGTGTTCCTGTT
CCAGTTGCTCGCGCTGGTGGGCGAATGGGATCGCGCGGCCAACCAATTGAAGATGGCGGCCGAACTCGAC
GAGCGGAACACGCTGATGTCGACCGCCTATGAATTCGCGCTGCGCGGCGAGCACGAGCGCGCGGCCGTGC
TGGCCGGCGGCAAGTGCCCCGGCATCGCCGGCGAGCCGGCCGCCTGGCACGCGCCGCTGATCCGCGCGCT
GCACGCGCTGACCGAGAAGCGCATCGACGAGACGCTGGCGCAGCGCGCGCTCGCCTTCGACACGGCCGAG
ACCGTGGCCGGCAGCATCGACGGCGAGCCCTTCGAGTGGATCGCCGACGCCGATCCGCGCTTCGGCCCCT
GCCTGGAGCTGATCCTGAAGAGCGGCTACGTGTGGGCGCCGTTCTCGCAGTTGCGCTCGCTCGAGTTCGA
GGCACCCAGCGACCTGCGCGACAAGGTCTGGGCACCGGTCAAGCTGAGCTGGACGAGCGGCGCCGAATCG
GTGGGCTTCGTGCCCTGCCGCTACGCCGGCAGCGAGCGCTCCGGCATCGCCGACCTGGCGCTGGCCGCGG
GCACCTCCTGGTTCGAGCACGGCGAGGACTGCTTCACCGGCCGCGGCCAGCGCATGCTGGTGACCGATCG
CGCCGAGTATCCGCTGCTCGACGTGCGCTCGATCACCTTCGGCGCGCGCTGA