SecReT6
Protein ID: 330819518
SecReT6 ID430
T6SS typei3
Gene symbol-
Locus tagbgla_2g03920
StrainBurkholderia gladioli BSR3
Repliconchromosome II [GenBank: NC_015376] [Browse all T6SS(s) in this replicon]
Location [Strand]491694..492197 [+]
Producttype VI secretion system lysozyme-related protein
NoteTssE
UniProt IDF2LJK1
KEGG IDbgd:bgla_2g03920
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.30E-22, Aligned region: 36..144
Protein Sequence: 167 a.a.     [Download]
>gi|330819518|ref|YP_004348380.1| type VI secretion system lysozyme-related protein [Burkholderia gladioli BSR3]
MAELTPQERLQPSLLDRLTDLAPHEPEESREARVITAAKLRECVTRDIAALLNCTRQWEDEDLPGLEQVG
NSVLNFGIPDLAGSALSGIDAGELQSRIRAALLDFEPRLIADTVQVSVSTDASRMDSRSLSFRIDAEMWA
QPMPLGLYLRTDVDLETGEFRVSPMFG
 
Nucleotide Sequence: 504 bp     [Download]
>gi|330819133|ref|NC_015376.1|:491694-492197 Burkholderia gladioli BSR3 chromosome 2, complete sequence
ATGGCCGAACTGACCCCGCAGGAGCGCCTGCAGCCCTCGCTGCTCGACCGGCTGACCGACCTGGCGCCGC
ACGAGCCCGAGGAGAGCCGCGAGGCGCGCGTGATCACGGCCGCGAAGCTGCGCGAGTGCGTGACGCGCGA
TATCGCCGCGCTGCTGAACTGCACGCGCCAGTGGGAGGACGAGGATCTGCCCGGCCTCGAGCAGGTCGGC
AACTCGGTGCTCAACTTCGGGATTCCCGACCTGGCCGGCAGCGCGCTGTCGGGCATCGACGCGGGCGAGC
TGCAGAGCCGCATCCGCGCCGCGCTGCTCGACTTCGAGCCGCGCCTGATCGCCGATACCGTGCAGGTCAG
CGTCAGCACCGACGCCTCGCGCATGGACAGCCGCTCGCTGTCGTTCCGCATCGATGCCGAGATGTGGGCC
CAGCCGATGCCGCTCGGCCTCTACCTGCGCACCGACGTCGACCTCGAGACCGGCGAGTTCCGCGTCTCGC
CAATGTTCGGCTGA