SecReT6
Protein ID: 330819519
SecReT6 ID430
T6SS typei3
Gene symbol-
Locus tagbgla_2g03930
StrainBurkholderia gladioli BSR3
Repliconchromosome II [GenBank: NC_015376] [Browse all T6SS(s) in this replicon]
Location [Strand]492204..494093 [+]
Producthypothetical protein
NoteTssF
UniProt IDF2LJK2
KEGG IDbgd:bgla_2g03930
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.90E-220, Aligned region: 5..629
Protein Sequence: 629 a.a.     [Download]
>gi|330819519|ref|YP_004348381.1| hypothetical protein bgla_2g03930 [Burkholderia gladioli BSR3]
MDPRLLRYYNRELQHVREMGAEFASAYPKIAGRLGMEGFECADPYVERLLEGFAFLAARVQLKLDAQYPV
FTQHLLEMVYPHYLSPIPSMAVVQLHPDTAEDLPPAGHAVARHTVLRSLTGFGERTACEYRTAHEVRLWP
LELAEARYFDTPAALAAAGLVPPPGRAARAGLRLRFRTLAGAEAKMLALDTLPVYLAGADELPALLYEQL
LANGLGYTVRTASASEGEFVELHHERAALRASGFDEEQAMLPYGSRSFSGYRLLQEYFACPERFRFVEFT
GLRALLARARGKEFEIVVWLDRSVARLHNAIDAGNFRLFCTPAANLFERRADRIHLQGGRTEYHILGDRT
RPMDFEVHSVLEVQGYGDRQEPEQRFLPFYDSNSRNWHGGQAAFYTLRREPRLLSTRQKQNGARSSYVGS
ETFIALVDGKDAPYATSLRQLGLRLLCTNRDLPLHMPVGKSYTDFTLDTDAPVASIRCVAGPTRPRAPVA
TGETAWRLISHLQLNYLSLLEDEGEQGAASLREMLGLYHDEFDAAARRQVEGIRQASARPVTRRVPVPGP
ITYGRGLEITLTCADAAFEGSSAFLLGSVLQHFLARYVSLNAFTETVLRTQERNEVARWPATPGKRPIL
 
Nucleotide Sequence: 1890 bp     [Download]
>gi|330819133|ref|NC_015376.1|:492204-494093 Burkholderia gladioli BSR3 chromosome 2, complete sequence
ATGGATCCCCGCCTGCTTCGTTACTACAACCGCGAGCTCCAGCACGTGCGCGAGATGGGCGCCGAGTTCG
CGAGCGCCTATCCGAAGATCGCCGGCCGCCTCGGCATGGAAGGCTTCGAGTGCGCCGACCCTTACGTCGA
ACGCCTGCTGGAGGGTTTCGCCTTCCTCGCCGCGCGCGTGCAGCTCAAGCTCGACGCGCAGTACCCGGTG
TTCACCCAGCACCTGCTGGAGATGGTGTACCCGCATTACCTGTCGCCGATCCCGTCGATGGCGGTGGTGC
AGCTGCATCCCGACACGGCCGAGGACCTGCCGCCGGCCGGCCACGCGGTGGCGCGGCACACGGTGCTGCG
CAGCCTGACCGGCTTCGGCGAGCGCACCGCCTGCGAATACCGCACCGCGCACGAGGTCAGGCTCTGGCCG
CTGGAGCTGGCCGAGGCGCGCTACTTCGATACGCCGGCCGCGCTGGCCGCGGCGGGGCTGGTACCGCCGC
CGGGGCGCGCCGCGCGTGCCGGGCTGCGGCTGCGGTTTCGCACCCTGGCGGGTGCCGAGGCGAAGATGCT
CGCGCTCGACACGCTGCCGGTCTACCTGGCCGGCGCCGACGAGCTGCCGGCCCTGCTCTACGAGCAACTG
CTGGCCAACGGCCTGGGCTACACGGTGCGCACCGCCTCGGCCAGCGAGGGCGAATTCGTCGAGCTGCATC
ACGAGCGGGCCGCGCTGCGCGCCAGCGGCTTCGACGAGGAGCAGGCGATGCTGCCCTACGGCAGCCGCTC
GTTCAGCGGCTACCGGCTGCTGCAGGAATACTTCGCCTGCCCCGAGCGCTTCCGCTTCGTCGAATTCACC
GGCCTGCGCGCGCTGCTGGCTCGCGCGCGCGGCAAGGAGTTCGAGATCGTGGTGTGGCTCGACCGCAGCG
TGGCGCGCCTGCACAACGCGATCGACGCCGGCAATTTCAGGCTGTTCTGCACGCCGGCGGCCAACCTGTT
CGAGCGGCGCGCCGATCGCATCCACCTGCAGGGCGGGCGCACCGAATATCACATCCTCGGCGACCGCACG
CGGCCGATGGACTTCGAGGTGCACAGCGTGCTGGAAGTGCAGGGCTACGGCGATCGCCAGGAACCCGAGC
AGCGCTTCCTGCCGTTCTACGACAGCAATTCGCGCAACTGGCACGGCGGCCAGGCGGCCTTCTACACGCT
GCGTCGCGAGCCGCGCCTGCTCTCCACGCGGCAGAAGCAGAACGGCGCGCGCTCCAGCTACGTGGGCAGT
GAGACCTTCATCGCGCTGGTGGACGGCAAGGACGCGCCTTACGCCACCTCGCTGCGCCAGCTCGGCCTGC
GCCTGCTCTGCACCAATCGCGACCTGCCGCTGCACATGCCGGTGGGCAAGTCCTATACCGACTTCACGCT
CGACACCGACGCGCCGGTGGCCTCGATCCGCTGCGTGGCGGGCCCGACCCGGCCGCGCGCGCCGGTCGCC
ACCGGCGAGACCGCCTGGCGGCTGATCAGCCATCTGCAGCTGAACTACCTGTCGCTGCTGGAGGACGAGG
GCGAGCAGGGCGCGGCCTCGCTGCGCGAGATGCTGGGCCTCTACCACGACGAATTCGACGCCGCCGCGCG
CCGCCAGGTCGAGGGCATCCGCCAGGCCTCGGCGCGGCCGGTGACGCGCCGCGTGCCGGTGCCGGGCCCG
ATCACCTACGGGCGCGGCCTGGAGATCACCCTGACCTGCGCCGACGCGGCCTTCGAGGGCAGCAGCGCCT
TCCTGCTGGGCTCGGTGCTGCAGCATTTCCTGGCGCGCTACGTCTCGCTGAACGCCTTCACCGAGACCGT
GTTGCGCACCCAAGAACGCAACGAGGTGGCCCGATGGCCCGCAACGCCCGGCAAGCGCCCGATCCTGTAG