SecReT6
Protein ID: 330819520
SecReT6 ID430
T6SS typei3
Gene symbol-
Locus tagbgla_2g03940
StrainBurkholderia gladioli BSR3
Repliconchromosome II [GenBank: NC_015376] [Browse all T6SS(s) in this replicon]
Location [Strand]494057..495073 [+]
Producthypothetical protein
NoteTssG
UniProt IDF2LJK3
KEGG IDbgd:bgla_2g03940
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.70E-108, Aligned region: 20..321
Protein Sequence: 338 a.a.     [Download]
>gi|330819520|ref|YP_004348382.1| hypothetical protein bgla_2g03940 [Burkholderia gladioli BSR3]
MARNARQAPDPVALEAALRERPFDFEFFEAMRRLECAYPARPRLGHSTKPAEDPVRLAHAATLEFPARSI
ERFEPGTGGAPGRLHGLFLGLFGPQGPLPLHLTEHAVDRERNAKDPTLTAFADVFHHRMLSLFYRAWADA
QPTVQYDRPESDRFRTYVGALIGIATPRLQDRDALPDQFKRFFAGRLVPQARNAEGLRGLLEHYFGVPVQ
VLEFVVGWMTLPEDAHLRMGGAMASMGRNATLGAQVRGAQQRFRLRIGPLGLAEFNRFLPGGEALRELTA
AVKLYAGEEKGWDVQLVLKKEEVPASHLGQAGRMGFNTWMGRYAKPADADQVVLTPVA
 
Nucleotide Sequence: 1017 bp     [Download]
>gi|330819133|ref|NC_015376.1|:494057-495073 Burkholderia gladioli BSR3 chromosome 2, complete sequence
ATGGCCCGCAACGCCCGGCAAGCGCCCGATCCTGTAGCGCTGGAGGCGGCGCTGCGCGAGCGGCCGTTCG
ACTTCGAATTCTTCGAGGCGATGCGGCGGCTCGAATGCGCCTACCCGGCCCGCCCGCGCCTGGGCCACTC
GACCAAGCCGGCCGAGGATCCGGTGCGGCTCGCGCACGCGGCCACGCTGGAATTCCCGGCGCGCAGCATC
GAGCGTTTCGAGCCCGGCACGGGCGGCGCGCCGGGGCGGCTCCACGGGCTGTTCCTGGGCCTGTTCGGGC
CGCAGGGGCCGCTGCCGCTGCACCTCACCGAACACGCGGTGGACCGCGAGCGCAATGCCAAGGACCCCAC
GCTGACGGCCTTCGCCGACGTGTTCCATCACCGCATGCTGAGCCTGTTCTACCGCGCCTGGGCCGATGCA
CAGCCCACCGTGCAGTACGACCGGCCCGAGAGCGACCGCTTTCGCACCTATGTCGGCGCGCTGATCGGCA
TCGCCACGCCGCGCTTGCAGGACCGCGACGCGCTGCCGGACCAGTTCAAGCGCTTCTTCGCCGGGCGGCT
GGTGCCGCAGGCGCGCAATGCCGAGGGCCTGCGCGGCCTGCTGGAGCACTACTTCGGCGTGCCGGTGCAG
GTGCTCGAATTCGTGGTGGGCTGGATGACCCTGCCCGAGGACGCGCATCTGCGCATGGGCGGCGCGATGG
CCTCGATGGGCCGCAACGCCACGCTGGGCGCCCAGGTGCGCGGCGCGCAGCAGCGCTTCCGGCTGCGCAT
CGGCCCGCTCGGGCTGGCCGAGTTCAACCGCTTCCTGCCCGGCGGCGAGGCGCTGCGCGAGCTGACGGCC
GCCGTCAAGCTCTACGCGGGCGAGGAAAAGGGCTGGGACGTGCAGCTCGTGCTGAAGAAGGAGGAGGTGC
CTGCCAGCCACCTCGGGCAGGCGGGCCGGATGGGTTTCAACACCTGGATGGGGCGCTACGCCAAGCCGGC
CGATGCCGACCAGGTGGTGCTGACGCCGGTGGCCTAG