SecReT6
Protein ID: 330819521
SecReT6 ID430
T6SS typei3
Gene symbol-
Locus tagbgla_2g03950
StrainBurkholderia gladioli BSR3
Repliconchromosome II [GenBank: NC_015376] [Browse all T6SS(s) in this replicon]
Location [Strand]495159..498026 [+]
Producttype VI secretion ATPase, ClpV1 family
NoteTssH
UniProt IDF2LJK4
KEGG IDbgd:bgla_2g03950
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.40E-38, Aligned region: 246..262
AAA_2 [PF07724], Evalue: 1.40E-38, Aligned region: 668..834
AAA [PF00004], Evalue: 7.70E-18, Aligned region: 246..359
AAA [PF00004], Evalue: 7.70E-18, Aligned region: 674..758
ClpB_D2-small [PF10431], Evalue: 6.80E-13, Aligned region: 841..921
AAA_5 [PF07728], Evalue: 1.70E-11, Aligned region: 246..266
AAA_5 [PF07728], Evalue: 1.70E-11, Aligned region: 343..376
AAA_5 [PF07728], Evalue: 1.70E-11, Aligned region: 673..783
AAA_16 [PF13191], Evalue: 3.00E-08, Aligned region: 126..207
AAA_16 [PF13191], Evalue: 3.00E-08, Aligned region: 223..268
AAA_16 [PF13191], Evalue: 3.00E-08, Aligned region: 290..324
AAA_16 [PF13191], Evalue: 3.00E-08, Aligned region: 664..714
AAA_16 [PF13191], Evalue: 3.00E-08, Aligned region: 738..758
Sigma54_activat [PF00158], Evalue: 7.20E-07, Aligned region: 229..260
Sigma54_activat [PF00158], Evalue: 7.20E-07, Aligned region: 644..790
AAA_22 [PF13401], Evalue: 1.00E-06, Aligned region: 64..114
AAA_22 [PF13401], Evalue: 1.00E-06, Aligned region: 246..327
AAA_22 [PF13401], Evalue: 1.00E-06, Aligned region: 388..412
AAA_22 [PF13401], Evalue: 1.00E-06, Aligned region: 671..696
AAA_22 [PF13401], Evalue: 1.00E-06, Aligned region: 735..758
AAA_25 [PF13481], Evalue: 4.10E-06, Aligned region: 243..323
AAA_25 [PF13481], Evalue: 4.10E-06, Aligned region: 671..699
AAA_19 [PF13245], Evalue: 7.90E-05, Aligned region: 243..269
AAA_19 [PF13245], Evalue: 7.90E-05, Aligned region: 671..695
NACHT [PF05729], Evalue: 0.00013, Aligned region: 247..342
NACHT [PF05729], Evalue: 0.00013, Aligned region: 674..699
Zeta_toxin [PF06414], Evalue: 0.00022, Aligned region: 246..266
Zeta_toxin [PF06414], Evalue: 0.00022, Aligned region: 667..714
DUF815 [PF05673], Evalue: 0.00098, Aligned region: 238..321
DUF815 [PF05673], Evalue: 0.00098, Aligned region: 626..714
AAA_17 [PF13207], Evalue: 0.0015, Aligned region: 247..260
AAA_17 [PF13207], Evalue: 0.0015, Aligned region: 673..709
AAA_18 [PF13238], Evalue: 0.0021, Aligned region: 247..263
AAA_18 [PF13238], Evalue: 0.0021, Aligned region: 675..699
IstB_IS21 [PF01695], Evalue: 0.0036, Aligned region: 240..267
IstB_IS21 [PF01695], Evalue: 0.0036, Aligned region: 673..695
Hpr_kinase_C [PF07475], Evalue: 0.0039, Aligned region: 246..257
Hpr_kinase_C [PF07475], Evalue: 0.0039, Aligned region: 671..710
AAA_14 [PF13173], Evalue: 0.0044, Aligned region: 247..326
AAA_14 [PF13173], Evalue: 0.0044, Aligned region: 672..754
AAA_29 [PF13555], Evalue: 0.006, Aligned region: 236..261
AAA_29 [PF13555], Evalue: 0.006, Aligned region: 671..698
SRP54 [PF00448], Evalue: 0.0072, Aligned region: 245..266
SRP54 [PF00448], Evalue: 0.0072, Aligned region: 672..705
Protein Sequence: 955 a.a.     [Download]
>gi|330819521|ref|YP_004348383.1| type VI secretion ATPase, ClpV1 family [Burkholderia gladioli BSR3]
MDIMAEISRGALFGKLNAIAYRGIESATVFCKLRGNPNVELVHWIHQILQAQDSDLHRIVRHFGLNPSNL
ARDVTAALERLPRGSTTISDLSSEVEEAVERGWVFATLMFGEAQVRTGYLLVGMLRTRHLRHALQAVSAE
FGKLRPETLADEFAAIVAGSPEDSLGATDGFRADAVGATGAAGAAPGEASGALAPAQMGRQQALQQFTVD
LTAQAREGRIDPIVGRDGEIRQVVDILMRRRQNNPMLVGEAGVGKTAVVEGFALRIARGDVPPALKEVQV
RTLDIGLLQAGASMKGEFENRLRQVIDEVQASPRPVILFIDEAHTLVGAGGAAGTGDAANLLKPALARGN
LRTIGATTWAEYRKHIEKDPALTRRFQTVPVDEPDEAKAVLMMRGVASVMERHHRVQVLDEALEAAVKLS
HRYIPARQLPDKSVSLLDTACARVAISQHAVPAEIDDTLKRIEALETEQAIIARERQIGIEVEARETQAA
TALEAQRARLATLEAAWAGEKALVERILSLRAQLRGELRPVDGTGSLGAPEAGAVDVEAAPPTQAPALEP
AVDGAAPAVLDEAARAAVLAELRALQAELAELQGESPLILPSVDYQAVASVVADWTGIPVGRMLRSELQT
VMNLANLMCERVIGQDHAMEAIAKRIQTSRAGLDNPDRPIGVFMLAGTSGVGKTETALALAEALYGGEHN
LITINMSEFQEAHAVSTLKGAPPGYVGYGEGGVLTEAVRRKPYSVVLLDEVEKAHPDVHELFFQVFDKGV
MEDGEGRSINFRNTLILLTTNIGTELIAGLCRDPELMPDAEGLAKALREPLLKAFPPALLGRLVAIPYFP
LSAGMLGRIVRLQLERIRRRVEARYRVPFDYDDAVVQLVVGRCTESESGGRMIDAILTNTMLPAVSREFL
TRMIDGGEVARVSVGVEHGDFAYRFDMQAPVPGPVATQALALPRA
 
Nucleotide Sequence: 2868 bp     [Download]
>gi|330819133|ref|NC_015376.1|:495159-498026 Burkholderia gladioli BSR3 chromosome 2, complete sequence
ATGGACATCATGGCCGAGATCAGTCGCGGCGCCTTGTTCGGCAAGCTCAACGCGATCGCCTACCGGGGCA
TCGAAAGCGCCACCGTGTTCTGCAAGCTGCGCGGTAACCCCAACGTGGAGCTGGTGCACTGGATCCACCA
GATCCTGCAGGCGCAGGATTCCGACCTGCATCGCATCGTGCGCCACTTCGGGCTCAACCCCTCGAACCTG
GCGCGCGACGTGACGGCCGCGCTGGAGCGCCTGCCGCGCGGCAGCACCACGATCTCCGACCTGTCCTCCG
AGGTGGAGGAGGCGGTCGAGCGCGGCTGGGTGTTCGCCACCCTGATGTTCGGCGAGGCCCAGGTGCGCAC
CGGCTACCTGCTGGTCGGCATGCTGCGCACGCGCCATCTGCGCCACGCGCTGCAGGCGGTTTCGGCCGAG
TTCGGCAAGCTCAGGCCCGAGACGCTGGCCGACGAGTTCGCCGCGATCGTGGCCGGCTCGCCCGAGGACA
GCCTGGGCGCCACCGACGGCTTCCGCGCCGACGCAGTGGGCGCAACGGGCGCGGCGGGGGCCGCCCCGGG
CGAGGCCAGCGGCGCGCTGGCGCCGGCCCAGATGGGCCGCCAGCAGGCCTTGCAGCAGTTCACCGTGGAT
CTCACCGCGCAGGCGCGCGAGGGCCGCATCGACCCGATCGTCGGCCGCGACGGCGAGATCCGCCAGGTGG
TCGACATCCTGATGCGGCGCCGCCAGAACAACCCGATGCTGGTGGGCGAGGCCGGCGTGGGCAAGACCGC
CGTGGTGGAGGGTTTCGCGCTGCGCATCGCGCGCGGCGACGTGCCGCCCGCGCTCAAGGAGGTGCAGGTG
CGCACGCTCGACATCGGCCTGCTGCAGGCGGGCGCGAGCATGAAGGGCGAGTTCGAGAACCGCCTGCGCC
AGGTGATCGACGAGGTGCAGGCCTCGCCGCGCCCGGTGATCCTGTTCATCGACGAGGCGCACACGCTGGT
GGGCGCGGGCGGCGCGGCCGGCACCGGCGACGCGGCCAACCTGCTCAAGCCAGCCCTGGCGCGCGGCAAC
CTGCGCACCATCGGCGCCACCACCTGGGCCGAGTACCGCAAGCACATCGAGAAGGACCCGGCGCTCACGC
GGCGCTTCCAGACCGTGCCGGTGGACGAGCCCGACGAGGCCAAGGCGGTCCTGATGATGCGCGGCGTGGC
CAGCGTGATGGAGCGCCACCACCGCGTGCAGGTGCTCGACGAGGCGCTGGAGGCCGCCGTCAAGCTCTCG
CATCGCTACATCCCGGCACGCCAGTTGCCCGACAAGTCGGTCAGCCTGCTCGACACCGCCTGCGCGCGCG
TGGCGATCAGCCAGCACGCGGTGCCGGCCGAGATCGACGACACCCTCAAGCGCATCGAGGCGCTCGAGAC
CGAGCAGGCCATCATCGCGCGCGAGCGGCAGATCGGCATCGAGGTGGAGGCCCGCGAGACGCAGGCTGCC
ACCGCGCTGGAGGCGCAACGCGCGCGGCTGGCCACGCTGGAGGCCGCCTGGGCCGGCGAGAAGGCGCTGG
TGGAGCGGATCCTTTCGTTGCGCGCGCAACTGCGCGGCGAGCTGCGGCCGGTGGACGGCACCGGCAGCCT
CGGCGCGCCCGAGGCCGGCGCCGTCGATGTCGAGGCCGCGCCGCCGACGCAGGCGCCGGCGCTCGAGCCC
GCCGTCGACGGCGCGGCGCCCGCCGTGCTCGACGAAGCCGCGCGCGCGGCCGTGCTGGCCGAACTGCGCG
CCTTGCAGGCCGAGCTGGCCGAGCTGCAGGGCGAGAGCCCGCTGATCCTGCCGAGCGTCGACTACCAGGC
GGTCGCCTCGGTGGTGGCCGACTGGACCGGCATCCCGGTGGGCCGCATGCTGCGCAGCGAACTGCAGACC
GTGATGAACCTCGCGAACCTGATGTGCGAGCGCGTGATCGGCCAGGACCACGCGATGGAGGCGATCGCCA
AGCGGATCCAGACCTCGCGCGCCGGGCTCGACAATCCCGACCGCCCGATCGGCGTGTTCATGCTGGCCGG
CACCTCGGGCGTGGGCAAGACCGAGACCGCGCTGGCGCTGGCCGAGGCCTTGTACGGCGGCGAGCACAAC
CTGATCACCATCAACATGAGCGAGTTCCAGGAGGCGCATGCCGTCTCCACGCTCAAGGGCGCGCCGCCGG
GCTACGTCGGTTACGGCGAGGGCGGCGTGCTGACCGAGGCGGTGCGCCGCAAGCCGTATTCGGTGGTGCT
GCTCGACGAGGTCGAGAAGGCGCATCCGGACGTGCACGAGCTGTTCTTCCAGGTGTTCGACAAGGGCGTG
ATGGAGGACGGCGAGGGCCGCTCGATCAACTTCCGCAACACGCTGATCCTGCTGACCACCAATATCGGCA
CCGAGCTGATCGCCGGCCTGTGCCGCGATCCGGAGCTGATGCCCGATGCCGAGGGCCTCGCCAAGGCGCT
GCGCGAGCCGCTCCTGAAGGCCTTCCCGCCCGCGCTGCTGGGCCGCCTGGTGGCGATCCCGTATTTCCCG
CTCAGCGCCGGGATGCTGGGGCGCATCGTGAGGCTGCAACTGGAGCGCATCCGCCGCCGCGTCGAGGCAC
GCTACCGCGTGCCCTTCGACTACGACGATGCCGTGGTGCAACTGGTGGTGGGCCGCTGCACCGAGAGCGA
GTCGGGCGGCCGCATGATCGACGCGATCCTGACCAACACCATGCTGCCCGCCGTCAGCCGCGAGTTCCTC
ACGCGCATGATCGACGGCGGCGAGGTGGCGCGCGTGAGCGTGGGCGTCGAGCACGGCGATTTCGCCTATC
GCTTCGACATGCAGGCGCCGGTGCCGGGCCCGGTCGCCACGCAGGCGCTGGCCTTGCCCCGGGCTTGA