SecReT6
Protein ID: 330819524
SecReT6 ID430
T6SS typei3
Gene symbol-
Locus tagbgla_2g03980
StrainBurkholderia gladioli BSR3
Repliconchromosome II [GenBank: NC_015376] [Browse all T6SS(s) in this replicon]
Location [Strand]501061..502947 [+]
Productrhs-family protein
NoteTssI
UniProt IDF2LJK7
KEGG IDbgd:bgla_2g03980
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 7.60E-77, Aligned region: 23..334
Phage_base_V [PF04717], Evalue: 3.60E-24, Aligned region: 377..470
DUF2345 [PF10106], Evalue: 0.0021, Aligned region: 505..590
Protein Sequence: 628 a.a.     [Download]
>gi|330819524|ref|YP_004348386.1| rhs-family protein [Burkholderia gladioli BSR3]
MAHAITLSSNLGSSLLFSNLSAEEALGRLFAYRLEAISKNASADLRALLGTPMTVKLVSPQGYTRYFNGI
VRDAQQSGFVNIDGVRYAVYGFTLVPKPWLSTRRRDCRIYRGMTVPQIVQSVLNDVGYSDVKPSLSGSYP
AREYCVQYRESDFDFISRLMEQEGIYYFFTHAEGSHTMVLADALGAHTTVPSFEQIPYAPPTERGKRMKA
SISDWQTSREVNTTRVQLDDYDYLKPKASLLASEELTDQADATSVGGLEVYDWSYEYVGYDQKQSDGQRY
AQVRADALNVPLLLSQGSTDACGLATGVLFRLKDFPLADANQEYLVTETEIRLVEPDYVTGGGIDDDEEP
FRCSFKAIHGRQPFRTAQTTPRPRIAGLQTAVVHGDTAEDIAVDKYGRVQVTFFWSRPGKPHADNSCPVR
VAQLWAGKRWGAQFIPRVGQEVVVSFLDGNPDRPLIIGSVYNADNMPPYSLPDNKTQSGVKSRSHQGGGS
EDYNEIRFEDRKGAEQVLVHAQKDLREESEHDHDVQVGHSYTLTAGNQIRLVTGLASITMKSSGEIDIQG
TNLTINGEMNVTLMSGIAMEINSKANLNMSSIAAMEILSEADCLIQSTNLQLIGTATAVLGGDMPMIL
 
Nucleotide Sequence: 1887 bp     [Download]
>gi|330819133|ref|NC_015376.1|:501061-502947 Burkholderia gladioli BSR3 chromosome 2, complete sequence
ATGGCTCACGCAATCACGCTCAGCTCCAATCTCGGCAGCAGCCTGCTGTTCTCGAACCTCAGCGCCGAGG
AAGCACTCGGCCGCCTGTTCGCCTACCGGCTCGAGGCGATCAGCAAGAACGCCTCGGCCGACCTGCGCGC
GCTGCTCGGCACGCCGATGACGGTCAAGCTGGTCAGCCCGCAGGGCTACACGCGCTATTTCAACGGCATC
GTGCGCGATGCGCAGCAGAGCGGCTTCGTCAATATCGATGGCGTGCGCTACGCGGTCTACGGTTTCACCC
TGGTGCCCAAGCCCTGGCTCTCGACGCGCCGCCGCGACTGCCGCATCTATCGCGGCATGACGGTGCCGCA
GATCGTGCAGTCGGTGCTCAACGACGTGGGCTACAGCGACGTGAAGCCGAGCCTGAGCGGCAGCTACCCG
GCGCGCGAATACTGCGTGCAGTACCGCGAGAGCGATTTCGACTTCATCAGCCGGCTGATGGAGCAGGAAG
GCATCTACTACTTCTTCACGCATGCCGAGGGCAGCCACACCATGGTGCTGGCCGACGCGCTCGGCGCGCA
TACCACGGTGCCGAGCTTCGAGCAGATTCCCTATGCGCCGCCCACCGAGCGCGGCAAGCGCATGAAGGCC
TCGATCAGCGACTGGCAAACCTCGCGCGAGGTCAACACCACGCGCGTGCAGCTCGACGACTACGACTACC
TGAAGCCGAAGGCCTCGCTGCTGGCCTCGGAGGAATTGACCGACCAGGCCGACGCGACCAGCGTCGGCGG
CCTGGAAGTGTACGACTGGTCCTACGAATACGTCGGCTACGACCAGAAGCAGTCGGACGGCCAGCGTTAC
GCGCAGGTGCGCGCCGATGCGCTGAACGTGCCGCTGCTGCTCAGCCAGGGCAGCACCGATGCCTGCGGCC
TGGCCACCGGCGTGCTGTTCCGCCTCAAGGATTTCCCGCTGGCCGACGCGAACCAGGAATACCTCGTCAC
CGAGACCGAGATCCGGCTGGTCGAGCCCGACTACGTGACCGGCGGCGGCATCGACGACGACGAGGAGCCG
TTTCGCTGCAGCTTCAAGGCGATCCACGGCCGCCAGCCGTTCCGCACCGCGCAGACCACCCCGCGGCCGC
GCATCGCCGGGCTGCAGACGGCGGTGGTGCATGGCGACACGGCCGAGGACATCGCGGTCGACAAATACGG
CCGCGTGCAGGTGACGTTTTTCTGGAGTCGCCCCGGCAAGCCGCATGCCGACAATTCCTGCCCGGTGCGG
GTGGCCCAGCTGTGGGCCGGCAAGCGCTGGGGCGCGCAGTTCATTCCGCGCGTCGGGCAGGAGGTGGTGG
TCAGCTTCCTGGACGGCAATCCGGACCGGCCGCTGATCATCGGCAGCGTCTACAACGCCGACAACATGCC
GCCCTACAGCCTGCCCGACAACAAGACCCAGAGCGGCGTGAAGAGCCGCAGCCACCAGGGCGGCGGCAGC
GAGGACTACAACGAGATCCGCTTCGAGGACCGCAAGGGCGCCGAGCAGGTGCTGGTGCATGCGCAGAAGG
ACCTGCGCGAGGAATCCGAGCACGACCACGACGTGCAGGTGGGCCACAGCTACACGCTGACGGCCGGCAA
CCAGATCCGCCTGGTCACCGGGCTGGCCAGCATCACCATGAAGAGCTCGGGCGAGATCGATATCCAGGGC
ACCAACCTGACCATCAACGGCGAGATGAACGTGACCCTGATGTCGGGCATCGCGATGGAGATCAACTCCA
AGGCGAACCTGAACATGAGCTCGATCGCGGCGATGGAGATCCTCTCCGAGGCCGACTGCCTGATCCAGTC
GACCAACCTGCAGTTGATCGGCACGGCCACGGCCGTCCTGGGCGGCGACATGCCGATGATCCTGTGA