SecReT6
Protein ID: 330819526
SecReT6 ID430
T6SS typei3
Gene symbol-
Locus tagbgla_2g04000
StrainBurkholderia gladioli BSR3
Repliconchromosome II [GenBank: NC_015376] [Browse all T6SS(s) in this replicon]
Location [Strand]503489..505636 [+]
ProductFHA domain containing protein
NoteFha
UniProt IDF2LJK9
KEGG IDbgd:bgla_2g04000
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 2.40E-17, Aligned region: 32..95
Protein Sequence: 715 a.a.     [Download]
>gi|330819526|ref|YP_004348388.1| FHA domain containing protein [Burkholderia gladioli BSR3]
MSTEPSLTLAVQGERAERLAQREQRFDRRDGSIGRADDCDWVLGAEGVSRLHALIRYLNGLYFVEDRSTN
GMLLNGAPLRKGDPAALRDGDRLQIDTFEIAVRLGGETGGHWQDRQAQTDRAPTAPASTSTPRVPPVPVV
PAAGAAALSSSSSSSSAENREPLDLGALLSPRQLDAQGDAGRPDGLIPGARDAAVPGSSLDPLALFDAPS
SYYDEAPGAVPADQGWNHTPSPSDRFRPPRVAGARPAGALLPDDWDATGSRFTPPAAPSARQWDDSLLAP
ASNAAPAIPPAASGGDDSLLAPAPLRAAESAPAMQSSASYQDDARPGSSRAGGAAPVIPPSASREDDSLL
GSIPPRAAGVAPVIPSSALHQDDSLLGSIPPRAAGAASVPPSSARHQDDSSSDAISARARGAAPVPSPSH
SDDSLPRSATVAPAAPQHDDALLDLIPARAADAAPVLPSSALRHGDSLLAPIPAHAAEASPLAPGNPAAR
DQAAPSAARASAADAAPSTRAPAAAVESAAPVARPVAFGAAEASPRSQAASPAEPAGADLTAMFEIAVDA
MMDVLRARAELKNSFRLPATLIQRSENNPLKFAPTAREAVRRLLAPPDNGFLAGSAALADAADDIRNHQM
AMLAGVRSAFESLLAQFDPARIEQESEGGGRRLSLGGNRPRHWERYKEQFEALTRNPDECFRRLFGDEFA
RAYEEQLARLKQRRP
 
Nucleotide Sequence: 2148 bp     [Download]
>gi|330819133|ref|NC_015376.1|:503489-505636 Burkholderia gladioli BSR3 chromosome 2, complete sequence
ATGAGCACCGAACCGAGCCTGACCCTGGCGGTGCAGGGTGAACGCGCCGAGCGCCTCGCGCAGCGCGAGC
AACGCTTCGACCGCCGCGACGGCAGCATCGGCCGCGCCGACGATTGCGACTGGGTGCTCGGCGCCGAGGG
CGTGTCGCGGCTGCATGCGCTGATCCGCTACCTGAACGGGCTCTACTTCGTCGAGGACCGCAGCACCAAC
GGCATGCTGCTGAACGGCGCGCCGCTGCGCAAGGGCGACCCGGCGGCGCTGCGCGACGGCGACCGCCTGC
AGATCGACACCTTCGAGATCGCGGTGCGGCTCGGCGGCGAGACCGGCGGCCACTGGCAGGACCGGCAGGC
GCAGACCGATCGCGCGCCGACGGCGCCGGCTTCGACGTCGACGCCGCGGGTTCCGCCGGTGCCGGTCGTG
CCGGCAGCCGGCGCGGCCGCGCTGTCGTCATCGTCGTCATCGTCGTCGGCCGAGAACCGCGAGCCGCTCG
ATCTCGGCGCGCTGCTTTCGCCGCGCCAGCTCGATGCGCAGGGCGATGCGGGCCGTCCCGACGGCCTGAT
CCCCGGCGCGCGCGATGCGGCCGTGCCGGGTTCGAGTCTCGATCCGCTCGCGCTGTTTGATGCCCCCTCG
TCCTATTACGACGAGGCACCCGGCGCGGTGCCGGCCGACCAGGGCTGGAACCACACGCCGTCGCCCTCGG
ATCGATTCCGGCCGCCCCGGGTGGCGGGCGCGCGCCCGGCCGGCGCCTTGCTGCCCGACGATTGGGACGC
CACCGGCAGTCGCTTCACGCCGCCGGCCGCGCCGTCCGCGCGCCAGTGGGACGATTCGCTGCTCGCGCCC
GCGTCGAATGCCGCGCCGGCGATTCCGCCCGCTGCTTCGGGCGGGGACGATTCCTTGCTGGCACCCGCGC
CGCTGCGTGCCGCCGAGTCCGCGCCTGCGATGCAGTCGAGCGCCTCGTACCAGGACGACGCGCGGCCGGG
TTCGAGCCGGGCGGGCGGTGCCGCGCCGGTGATTCCGCCGTCGGCCTCGCGCGAGGACGATTCGCTGCTG
GGTTCGATTCCGCCGCGAGCGGCGGGTGTCGCGCCGGTGATTCCGTCGTCGGCCCTGCACCAGGACGATT
CGCTGCTGGGTTCGATTCCGCCGCGTGCGGCTGGCGCTGCTTCGGTGCCGCCGTCCTCGGCCCGGCATCA
GGACGATTCGTCGTCGGATGCGATTTCGGCGCGCGCGAGGGGTGCCGCGCCGGTGCCGTCGCCGTCGCAT
TCGGACGACTCGCTGCCGCGCTCGGCGACTGTCGCGCCGGCCGCCCCGCAGCATGACGATGCGCTGCTGG
ACTTGATCCCGGCGCGCGCGGCCGATGCCGCGCCGGTGCTTCCGTCGTCTGCGCTGCGGCACGGTGATTC
GCTGCTGGCCCCGATCCCGGCACATGCCGCCGAGGCGTCGCCGCTCGCGCCGGGCAACCCGGCCGCGCGC
GATCAAGCCGCCCCGTCCGCCGCGCGGGCCTCGGCCGCCGACGCCGCGCCGTCCACGCGTGCCCCGGCCG
CCGCCGTGGAATCGGCGGCGCCGGTGGCGCGGCCCGTGGCCTTCGGCGCGGCCGAAGCCTCGCCCCGCTC
GCAGGCGGCATCGCCCGCCGAACCGGCCGGCGCCGACCTCACGGCGATGTTCGAGATCGCCGTCGACGCG
ATGATGGACGTGCTGCGCGCGCGCGCCGAGCTGAAGAACAGCTTCCGCCTGCCGGCCACGCTGATCCAGC
GCTCCGAGAACAACCCGCTGAAGTTCGCGCCCACCGCGCGCGAGGCCGTGCGCCGCCTGCTCGCGCCGCC
CGACAACGGCTTCCTGGCCGGCAGCGCGGCGCTGGCCGACGCGGCCGACGATATCCGCAACCACCAGATG
GCGATGCTGGCCGGCGTGCGCTCGGCCTTCGAGTCCCTGCTCGCGCAGTTCGATCCGGCGCGCATCGAGC
AGGAGTCCGAAGGCGGCGGGCGGCGGCTCTCGCTGGGCGGCAATCGCCCGCGCCACTGGGAGCGCTACAA
GGAGCAGTTCGAGGCGCTCACGCGCAATCCCGACGAATGCTTCCGGCGCCTGTTCGGCGACGAATTCGCG
CGCGCCTACGAGGAACAACTGGCGCGCCTGAAGCAGCGCCGCCCCTGA