SecReT6
Protein ID: 330819527
SecReT6 ID430
T6SS typei3
Gene symbol-
Locus tagbgla_2g04010
StrainBurkholderia gladioli BSR3
Repliconchromosome II [GenBank: NC_015376] [Browse all T6SS(s) in this replicon]
Location [Strand]505705..507042 [+]
Producthypothetical protein
NoteTssK
UniProt IDF2LJL0
KEGG IDbgd:bgla_2g04010
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 8.20E-154, Aligned region: 19..444
Protein Sequence: 445 a.a.     [Download]
>gi|330819527|ref|YP_004348389.1| hypothetical protein bgla_2g04010 [Burkholderia gladioli BSR3]
MTQSNKVVWSEGLFLRPQHMQQQERYLERYVELRAGALRPHAWGFQELELESDLLAIGKLGIKRARGVFP
DGTPFAMPGDDPLPPPLDIESNWRDQVVHLTLPLRSATQPDSAWPGADGDQLYRYRVREAEVRDASGSME
GLTALEVAGMSARLVPDAQPTEGLMRIPVARVVECRADRRVVLDEGFMPSALNTEAAARLVTFLSELLGL
LHQRGEALAGRVAETDRGGAAEIADFLMLQVINRYQPLVAHLAAAPLLHPEALYQLLIELAGELATFTAP
GKRAQAFPPYRHEMLRESFEPVIVALRIALSAVLEQSAVPIPLQQRKYGVWVGVVPDLTLLDTATFVLAA
KADMKAEDMRRQLPTQSKIGPVEKIRDLVNLQLPGIGVSPMAVAPRQLPYTSGFLYFECDRNSSMWRMLK
TSGGIAMHFGSGFAGLDLQFWAVRT
 
Nucleotide Sequence: 1338 bp     [Download]
>gi|330819133|ref|NC_015376.1|:505705-507042 Burkholderia gladioli BSR3 chromosome 2, complete sequence
ATGACCCAGAGCAATAAAGTGGTATGGAGCGAGGGCCTGTTCCTGCGGCCCCAGCACATGCAGCAGCAGG
AGCGCTACTTGGAGCGCTACGTGGAGCTGCGCGCCGGCGCGCTGCGTCCGCACGCGTGGGGCTTCCAGGA
GCTCGAGCTGGAGAGCGACCTGCTCGCGATCGGCAAGCTCGGCATCAAGCGCGCGCGCGGCGTGTTTCCC
GACGGCACGCCGTTCGCGATGCCCGGCGACGATCCGCTGCCGCCGCCGCTCGACATCGAATCGAACTGGC
GCGACCAGGTGGTGCACCTGACCTTGCCGCTGCGCTCGGCCACCCAGCCCGACAGCGCCTGGCCCGGCGC
CGACGGCGACCAGTTGTATCGCTACCGGGTGCGCGAGGCCGAGGTGCGCGACGCCTCGGGCAGCATGGAA
GGGCTGACCGCGCTGGAGGTGGCCGGCATGAGCGCGCGCCTGGTGCCCGACGCGCAGCCCACCGAGGGCC
TGATGCGGATCCCGGTGGCGCGCGTGGTGGAGTGCCGTGCCGATCGCCGCGTGGTGCTCGACGAGGGCTT
CATGCCCAGCGCCCTGAACACCGAGGCGGCCGCGCGGCTGGTGACCTTCCTCTCCGAGCTGCTGGGCCTG
CTGCACCAGCGCGGCGAGGCGCTGGCCGGGCGCGTGGCCGAGACCGATCGCGGCGGCGCGGCCGAGATCG
CCGACTTCCTGATGCTGCAGGTGATCAACCGCTACCAGCCGCTGGTGGCGCACCTGGCCGCCGCGCCGCT
GCTGCATCCCGAGGCGCTCTACCAGTTGCTGATCGAGCTGGCCGGCGAGCTGGCCACCTTCACGGCGCCG
GGCAAGCGCGCGCAGGCCTTCCCGCCGTATCGCCACGAGATGCTGCGCGAGAGCTTCGAGCCGGTGATCG
TGGCGCTGCGCATCGCGCTGAGCGCGGTGCTCGAGCAGAGCGCCGTGCCGATCCCGCTGCAGCAGCGCAA
GTACGGCGTGTGGGTGGGCGTGGTGCCCGACCTCACGCTGCTCGACACCGCCACCTTCGTGCTGGCCGCC
AAGGCCGACATGAAGGCCGAGGACATGCGCCGGCAATTGCCGACGCAGTCGAAGATCGGCCCGGTCGAGA
AGATCCGCGACCTGGTCAACCTGCAACTGCCCGGCATCGGCGTCTCGCCGATGGCCGTCGCCCCGCGCCA
GCTTCCCTACACCTCCGGCTTCCTCTACTTCGAATGCGACCGCAATTCGTCGATGTGGCGGATGCTGAAG
ACCTCGGGCGGCATCGCCATGCACTTCGGCAGCGGCTTCGCGGGCCTCGACCTGCAATTCTGGGCGGTGC
GCACATGA